Sequence 1: | NP_787975.1 | Gene: | fipi / 33676 | FlyBaseID: | FBgn0031627 | Length: | 450 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_573102.1 | Gene: | dpr18 / 32572 | FlyBaseID: | FBgn0030723 | Length: | 519 | Species: | Drosophila melanogaster |
Alignment Length: | 252 | Identity: | 46/252 - (18%) |
---|---|---|---|
Similarity: | 82/252 - (32%) | Gaps: | 105/252 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 SPDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKSFD 112
Fly 113 LIVYQKITFTENATVMT-----------------VKEGEKATILCEV-----KGEPQP------- 148
Fly 149 ----------------------NVTWH-FNGQPIS-------AGAADDSKFR-------ILADGL 176
Fly 177 LINKVT-----QNDTGEYACRAYQVNSIASDMQERT--VLMKIEHKPIWSKTPFVSL 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fipi | NP_787975.1 | IG_like | 33..115 | CDD:214653 | 14/66 (21%) |
I-set | 128..202 | CDD:254352 | 19/144 (13%) | ||
Ig | 133..>193 | CDD:299845 | 18/113 (16%) | ||
IG_like | 228..307 | CDD:214653 | |||
Ig | 235..305 | CDD:143165 | |||
FN3 | 312..415 | CDD:238020 | |||
dpr18 | NP_573102.1 | IG_like | 242..325 | CDD:214653 | 17/78 (22%) |
Ig | <258..326 | CDD:299845 | 18/79 (23%) | ||
IGc2 | <417..461 | CDD:197706 | 7/43 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |