DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and dpr8

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:249 Identity:57/249 - (22%)
Similarity:89/249 - (35%) Gaps:60/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILNLAALTAVAWANHHESLSLSPAEHSVVRYTNESLIVQCRSPDPKVE-LHWKSPKGEIIREHKG 70
            :.||...| |:|..|.:...|     :|.|||..|        |.:.| :|  ||          
  Fly    66 VKNLGNRT-VSWVRHRDIHLL-----TVGRYTYTS--------DQRFEAMH--SP---------- 104

  Fly    71 RIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQKITFTENATVMTVKEGEK 135
              |.|..:   |:|.:|.  ..|.|.:.|:.:.......|..|.:.:.:|.......:.:..|..
  Fly   105 --HAEDWT---LRIRYAQ--RKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGST 162

  Fly   136 ATILCEVK--GEPQPNVTWHFNGQPISAGAADDSKFRILADG------LLINKVTQNDTGEYACR 192
            ..:.|.||  .||.|.|.|..|.:.|:..:.......:...|      ||:.|....|:|.|.| 
  Fly   163 INLTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTC- 226

  Fly   193 AYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPP 246
               ..|.|:....|..::..||.         :..:...||.:|     .::||
  Fly   227 ---TPSNANPTSVRVHIVDGEHP---------AAMHTGNNGNST-----ASQPP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 20/82 (24%)
I-set 128..202 CDD:254352 21/81 (26%)
Ig 133..>193 CDD:299845 19/67 (28%)
IG_like 228..307 CDD:214653 5/19 (26%)
Ig 235..305 CDD:143165 3/12 (25%)
FN3 312..415 CDD:238020
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 25/97 (26%)
V-set 52..143 CDD:284989 27/109 (25%)
IG_like 153..238 CDD:214653 21/88 (24%)
ig 153..232 CDD:278476 20/82 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.