| Sequence 1: | NP_787975.1 | Gene: | fipi / 33676 | FlyBaseID: | FBgn0031627 | Length: | 450 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_036019026.1 | Gene: | Negr1 / 320840 | MGIID: | 2444846 | Length: | 362 | Species: | Mus musculus |
| Alignment Length: | 344 | Identity: | 77/344 - (22%) |
|---|---|---|---|
| Similarity: | 129/344 - (37%) | Gaps: | 85/344 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 43 IVQCRSPDPKVELHWKSPKGEIIREHKG-----RIHIEQTSTEQLKIVFAHIALADKGNWSCE-- 100
Fly 101 AADGSLHSKSFDLIVYQKITFTENA-------------------TV------------MTVKEGE 134
Fly 135 KATILCEVKGEPQPNVTWHF---NGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRAYQV 196
Fly 197 NSIA-SDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTAT------LMCEALAEPPANFTWYRK 254
Fly 255 HNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGT----------IERTTRLEQG 309
Fly 310 EKPPSPANFQLRGFNSNTF 328 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| fipi | NP_787975.1 | IG_like | 33..115 | CDD:214653 | 14/78 (18%) |
| I-set | 128..202 | CDD:254352 | 21/77 (27%) | ||
| Ig | 133..>193 | CDD:299845 | 16/62 (26%) | ||
| IG_like | 228..307 | CDD:214653 | 30/94 (32%) | ||
| Ig | 235..305 | CDD:143165 | 27/85 (32%) | ||
| FN3 | 312..415 | CDD:238020 | 5/17 (29%) | ||
| Negr1 | XP_036019026.1 | FR1 | 38..55 | CDD:409353 | 4/18 (22%) |
| Ig strand A' | 40..46 | CDD:409353 | 1/7 (14%) | ||
| IG_like | 41..129 | CDD:214653 | 13/90 (14%) | ||
| Ig strand B | 48..56 | CDD:409353 | 1/7 (14%) | ||
| CDR1 | 56..60 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 61..68 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C | 61..67 | CDD:409353 | 0/5 (0%) | ||
| CDR2 | 69..79 | CDD:409353 | 2/9 (22%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 1/2 (50%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 80..115 | CDD:409353 | 5/35 (14%) | ||
| Ig strand D | 84..91 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 94..100 | CDD:409353 | 1/6 (17%) | ||
| Ig strand F | 107..115 | CDD:409353 | 0/7 (0%) | ||
| CDR3 | 116..120 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 120..129 | CDD:409353 | 0/8 (0%) | ||
| FR4 | 122..129 | CDD:409353 | 0/6 (0%) | ||
| Ig strand A' | 139..144 | CDD:409353 | 1/4 (25%) | ||
| IGc2 | 146..204 | CDD:197706 | 19/70 (27%) | ||
| Ig strand B | 150..157 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 163..168 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C' | 170..172 | CDD:409353 | 0/1 (0%) | ||
| Ig strand E | 180..186 | CDD:409353 | 2/16 (13%) | ||
| Ig strand F | 193..200 | CDD:409353 | 5/8 (63%) | ||
| Ig_3 | 219..295 | CDD:404760 | 22/75 (29%) | ||
| putative Ig strand A | 219..225 | CDD:409353 | 0/5 (0%) | ||
| Ig strand B | 235..239 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 248..252 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 288..293 | CDD:409353 | 3/4 (75%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167833602 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.740 | |||||