DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Nrg

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster


Alignment Length:345 Identity:81/345 - (23%)
Similarity:138/345 - (40%) Gaps:82/345 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LSLSPAEHSVVR-YTN--ESLIVQCR----------SPDPKV-------ELHWKSPKGEIIREHK 69
            :|.|..:|..|| |.:  :||.::.:          :|.|:.       .:.|..   .|.:.|.
  Fly   237 VSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLPQTVWSKDGQRIQWSD---RITQGHY 298

  Fly    70 GR-IHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKSFDLI--VYQKITFTENATVMTVK 131
            |: :.|.||:.:            |.|.::|:.::|..:::||.:|  |.....||:...:.|..
  Fly   299 GKSLVIRQTNFD------------DAGTYTCDVSNGVGNAQSFSIILNVNSVPYFTKEPEIATAA 351

  Fly   132 EGEKATILCEVKGEPQPNVTWHFNGQPISAGAAD------DSKFRILADGLLINKVTQNDTGEYA 190
            |.|:....|...|.|:|.::|..||:||.....:      |:..||:       .:.:.|||.|.
  Fly   352 EDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTDNTIRII-------NLVKGDTGNYG 409

  Fly   191 CRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYIN----GTATLMCEALAEPPANFTW 251
            |.|  .||:....::  |.:.::.:|     |.:|...|.::    ...|:.|.....|.....|
  Fly   410 CNA--TNSLGYVYKD--VYLNVQAEP-----PTISEAPAAVSTVDGRNVTIKCRVNGSPKPLVKW 465

  Fly   252 YRKHNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTIE--------RTTRLEQ 308
            .|..|.|....  |.:|::   ..|.|..:..|....|.|.|:|..|.|:        ..||:.|
  Fly   466 LRASNWLTGGR--YNVQAN---GDLEIQDVTFSDAGKYTCYAQNKFGEIQADGSLVVKEHTRITQ 525

  Fly   309 GEKPPSPANFQLRGFNSNTF 328
                 .|.|:::....|.||
  Fly   526 -----EPQNYEVAAGQSATF 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 21/104 (20%)
I-set 128..202 CDD:254352 23/79 (29%)
Ig 133..>193 CDD:299845 18/65 (28%)
IG_like 228..307 CDD:214653 21/90 (23%)
Ig 235..305 CDD:143165 18/77 (23%)
FN3 312..415 CDD:238020 5/17 (29%)
NrgNP_001245581.1 Ig 55..128 CDD:299845
IG_like 57..127 CDD:214653
Ig 135..214 CDD:299845
IG_like 141..216 CDD:214653
ig 251..332 CDD:278476 17/95 (18%)
I-set 339..427 CDD:254352 26/98 (27%)
Ig 354..427 CDD:299845 22/83 (27%)
I-set 432..517 CDD:254352 21/89 (24%)
Ig 446..517 CDD:299845 18/75 (24%)
I-set 522..611 CDD:254352 7/24 (29%)
ig 525..609 CDD:278476 6/21 (29%)
FN3 613..707 CDD:238020
FN3 716..807 CDD:238020
fn3 817..905 CDD:278470
FN3 917..1004 CDD:238020
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.