DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and dpr14

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:257 Identity:53/257 - (20%)
Similarity:86/257 - (33%) Gaps:71/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 FTENATVMTVKEGEKATIL--CEVKGEPQPNVTWHFN----------GQPISAGAADDSKFRILA 173
            |.:..|.:.:.....:::.  |.|.......|:|...          ||...:|   ||::.:..
  Fly    75 FADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSG---DSRYSLEF 136

  Fly   174 D-----GLLINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPI---------------- 217
            :     .|||....:.|.|.|.|   ||:|               |.|:                
  Fly   137 EEPNDWKLLIQFANERDEGPYEC---QVSS---------------HPPLVLLVYLTIIVPHVEIL 183

  Fly   218 ---WSKTPFVSLKYAYINGTATLMC--EALAEPPANFTWYRKHNKLH--SNNRLYTIQSDSY--- 272
               .|.||   .||.....|..|.|  ..:..|.:..||......|:  ::....::::|..   
  Fly   184 DERGSATP---EKYYKAGSTIELQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGR 245

  Fly   273 -WSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPS--PANFQLRGFNSNTFDVV 331
             .|.|.|...|.....||.|...|:: |......:..||:|.:  .||...:..|::|..|:
  Fly   246 ALSRLYIANANRQDTGNYTCMLGNEI-TETVVVHVLNGEEPAAMQHANGSRQKANASTMVVL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653
I-set 128..202 CDD:254352 19/90 (21%)
Ig 133..>193 CDD:299845 16/76 (21%)
IG_like 228..307 CDD:214653 18/86 (21%)
Ig 235..305 CDD:143165 16/77 (21%)
FN3 312..415 CDD:238020 6/22 (27%)
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 18/85 (21%)
Ig 84..169 CDD:299845 21/105 (20%)
IG_like 191..279 CDD:214653 20/91 (22%)
Ig 201..274 CDD:143165 16/73 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.