DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and DIP-alpha

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:399 Identity:78/399 - (19%)
Similarity:154/399 - (38%) Gaps:97/399 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AEHSVVRYTNESLIVQCRSPDPKVEL-HWKSPKGEIIREHKGRIHIEQTSTEQLKIVFAHIALAD 93
            |:...::..:|::|..    :|:|.: |        :.::...:||:..|.|            |
  Fly    78 ADTKAIQAIHENVITH----NPRVTVSH--------LDQNTWNLHIKAVSEE------------D 118

  Fly    94 KGNWSCEAADGSLHSK--SFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNVTWHFNG 156
            :|.:.|:.....:.|:  ..|:::.......:.::.:.|.||....:.|..:|.|:|.|||.   
  Fly   119 RGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWR--- 180

  Fly   157 QPISAGAADDSKFRILADG--------------LLINKVTQNDTGEYACRAYQVNSIASDMQERT 207
                   .:|....:|.|.              |.::|:::|:.|.|.|.|  .|.:...:.:| 
  Fly   181 -------REDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIA--SNGVPPSVSKR- 235

  Fly   208 VLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSDS- 271
            :.:.|...|: .:.| ..|..|.:.....:.|...|.|.:...|.:...::...:..|.:|..| 
  Fly   236 ISLSIHFHPV-IQVP-NQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQ 298

  Fly   272 --YWSSLTIHVLNTSAFD--NYRCRARNDLGTIERTTRLEQGEKP---PSPANFQLRG------F 323
              |.:.:::.|......|  :|||.|:|.||.::.:.||.:...|   .:|.|...:|      .
  Fly   299 SMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNPLNGGGKGGGAGGSL 363

  Fly   324 NSNTFDVV-----LSAPRGPPDSPMGVNGFRIEYMTEMEFKTDAGKWTNARRKDYAFEEGATFLL 383
            :::..|::     :.....|.|.       .::|.:..:|:.:.|             ||..  |
  Fly   364 DADANDILKQKQQVKVTYQPEDE-------ELQYGSVEDFEAEGG-------------EGGG--L 406

  Fly   384 TNLEPDTVY 392
            |.|.|...|
  Fly   407 TPLSPHVYY 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 14/84 (17%)
I-set 128..202 CDD:254352 21/87 (24%)
Ig 133..>193 CDD:299845 17/73 (23%)
IG_like 228..307 CDD:214653 19/83 (23%)
Ig 235..305 CDD:143165 17/74 (23%)
FN3 312..415 CDD:238020 17/95 (18%)
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 13/74 (18%)
Ig 51..131 CDD:299845 13/76 (17%)
I-set 144..240 CDD:254352 22/108 (20%)
IGc2 159..228 CDD:197706 20/80 (25%)
Ig 244..337 CDD:299845 21/94 (22%)
I-set 244..337 CDD:254352 21/94 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.