DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and kirre

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster


Alignment Length:414 Identity:79/414 - (19%)
Similarity:138/414 - (33%) Gaps:121/414 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 HHESLSLSPAEHSVVR-YTNESLIVQCRSPDPKVELH--------WKSPKG-EIIREHKGRIHIE 75
            ||.:.....|:::..| |.:..|:::.:.. |||.:.        .|.|:| |:|...:...:..
  Fly   261 HHNTTFTCQAQNTADRTYRSAKLLLEVKYA-PKVIVSVVGGALAGGKIPEGAEVILSCQADANPH 324

  Fly    76 QTS-----TEQL-------KIVF------AHIALADKGNWSCE---AADGSLHSKSFDLIVYQKI 119
            :.|     .::|       |::.      .|.|:.     .||   |...|..||..| |.:..:
  Fly   325 ELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIV-----KCEVVNAVGKSEQSKKLD-ISFGPV 383

  Fly   120 TFTENATVMTVKEGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILADGLLINKVTQN 184
             |.:....:....|...::.|:|.|.|:|.:.|.........|.|.:.|.          ||:..
  Fly   384 -FRQRPVSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAAELKL----------KVSSE 437

  Fly   185 DTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVS---LKYAYINGTATLMCEALAEPP 246
            ..|.|.|:|. ||.......|.|:.:|        :.|.::   :::..:.|...:.|.|.:.|.
  Fly   438 TAGRYFCKAV-VNGFPEIGAEATLYVK--------RAPIITSHKVQFGGVGGRVKIDCLAFSIPK 493

  Fly   247 ANFTWYRKHNKL----HSNNRLYTIQS----DSYWSSLTIHVLNTSAFDNYRCRARNDLG----- 298
            |....:....|:    .::..:|..:.    :...::|.|.....:.|..|.|...|..|     
  Fly   494 AEHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLV 558

  Fly   299 -TIER-----------------------------TTRLEQGEKPPSPANFQLRGFNSNTFDVVLS 333
             |:.|                             ..|..:..|.|.||            ||:..
  Fly   559 ITLLREPGNIPVLLVVMGSMFCVAIILMIVMIIIVYRKRRSRKKPMPA------------DVIPE 611

  Fly   334 APRGPP-----DSPMGVNGFRIEY 352
            |.||..     .|.:....:.:||
  Fly   612 ASRGGDKLNELKSELRSKAYDVEY 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 23/112 (21%)
I-set 128..202 CDD:254352 18/73 (25%)
Ig 133..>193 CDD:299845 15/59 (25%)
IG_like 228..307 CDD:214653 17/121 (14%)
Ig 235..305 CDD:143165 15/112 (13%)
FN3 312..415 CDD:238020 11/46 (24%)
kirreNP_001245505.1 Ig 87..183 CDD:299845
IG_like 88..182 CDD:214653
C2-set_2 189..279 CDD:285423 4/17 (24%)
Ig_2 307..379 CDD:290606 16/77 (21%)
I-set 382..462 CDD:254352 21/91 (23%)
IGc2 396..446 CDD:197706 15/59 (25%)
Ig 466..561 CDD:299845 15/94 (16%)
IG_like 478..561 CDD:214653 14/82 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.