DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Iglon5

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_218634.5 Gene:Iglon5 / 308557 RGDID:1305344 Length:336 Species:Rattus norvegicus


Alignment Length:329 Identity:84/329 - (25%)
Similarity:124/329 - (37%) Gaps:92/329 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTAVAWANHHESLSLSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSPKGEIIREHKGRIHIEQT 77
            :|.|||.|....|.....     |:|:          ||:|.|...:|                 
  Rat    60 VTRVAWLNRSNILYAGND-----RWTS----------DPRVRLLINTP----------------- 92

  Fly    78 STEQLKIVFAHIALADKGNWSCEAADGSLHSKSFD-----------LIVYQKITFTENATVMTVK 131
              |:..|:...:.|.|:|.::|          ||.           |||:........::.:.|.
  Rat    93 --EEFSILITQVGLGDEGLYTC----------SFQTRHQPYTTQVYLIVHVPARIVNISSPVAVN 145

  Fly   132 EGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILADG-------LLINKVTQNDTGEY 189
            ||....:||...|.|:|.|||                 |.|.||       |.|:.:.:...|||
  Rat   146 EGGNVNLLCLAVGRPEPTVTW-----------------RQLRDGFTSEGEILEISDIQRGQAGEY 193

  Fly   190 ACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRK 254
            .|..:  |.:.|....|.||:.:.:.|  :.|...|.:.| :...|.|.|||:|.|||:|.||:.
  Rat   194 ECVTH--NGVNSAPDSRRVLVTVNYPP--TITDVTSARTA-LGRAALLRCEAMAVPPADFQWYKD 253

  Fly   255 HNKLHSNN-RLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRL-------EQGEK 311
            ...|.|.: ....:|::...|.|....::...:.||.|||.|.||....:.||       ....:
  Rat   254 DRLLSSGSAEGLKVQTERTRSMLLFANVSARHYGNYTCRAANRLGASSASMRLLRPGSLENSAPR 318

  Fly   312 PPSP 315
            ||.|
  Rat   319 PPGP 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 16/92 (17%)
I-set 128..202 CDD:254352 22/80 (28%)
Ig 133..>193 CDD:299845 19/66 (29%)
IG_like 228..307 CDD:214653 28/86 (33%)
Ig 235..305 CDD:143165 25/70 (36%)
FN3 312..415 CDD:238020 3/4 (75%)
Iglon5XP_218634.5 Ig 41..129 CDD:416386 22/112 (20%)
Ig strand A' 41..46 CDD:409353
Ig strand B 48..56 CDD:409353
CDR1 56..60 CDD:409353 84/329 (26%)
FR2 61..68 CDD:409353 4/6 (67%)
Ig strand C 61..67 CDD:409353 4/5 (80%)
CDR2 69..79 CDD:409353 1/14 (7%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 0/7 (0%)
FR3 80..115 CDD:409353 13/73 (18%)
Ig strand D 84..91 CDD:409353 2/6 (33%)
Ig strand E 94..100 CDD:409353 1/5 (20%)
Ig strand F 107..115 CDD:409353 3/17 (18%)
CDR3 116..120 CDD:409353 0/3 (0%)
Ig strand G 120..129 CDD:409353 1/8 (13%)
FR4 122..129 CDD:409353 1/6 (17%)
Ig strand A 132..137 CDD:409353 0/4 (0%)
Ig_3 134..199 CDD:404760 21/83 (25%)
Ig strand A' 140..145 CDD:409353 0/4 (0%)
Ig strand B 148..157 CDD:409353 2/8 (25%)
Ig strand C 163..167 CDD:409353 3/20 (15%)
Ig strand D 174..177 CDD:409353 0/2 (0%)
Ig strand E 178..183 CDD:409353 1/4 (25%)
Ig strand F 191..199 CDD:409353 4/9 (44%)
Ig_3 217..295 CDD:404760 26/80 (33%)
putative Ig strand A 218..224 CDD:409353 2/7 (29%)
Ig strand B 234..238 CDD:409353 2/3 (67%)
Ig strand C 247..251 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
Ig strand G 301..304 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337192
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.