Sequence 1: | NP_787975.1 | Gene: | fipi / 33676 | FlyBaseID: | FBgn0031627 | Length: | 450 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_218634.5 | Gene: | Iglon5 / 308557 | RGDID: | 1305344 | Length: | 336 | Species: | Rattus norvegicus |
Alignment Length: | 329 | Identity: | 84/329 - (25%) |
---|---|---|---|
Similarity: | 124/329 - (37%) | Gaps: | 92/329 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 LTAVAWANHHESLSLSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSPKGEIIREHKGRIHIEQT 77
Fly 78 STEQLKIVFAHIALADKGNWSCEAADGSLHSKSFD-----------LIVYQKITFTENATVMTVK 131
Fly 132 EGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILADG-------LLINKVTQNDTGEY 189
Fly 190 ACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRK 254
Fly 255 HNKLHSNN-RLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRL-------EQGEK 311
Fly 312 PPSP 315 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fipi | NP_787975.1 | IG_like | 33..115 | CDD:214653 | 16/92 (17%) |
I-set | 128..202 | CDD:254352 | 22/80 (28%) | ||
Ig | 133..>193 | CDD:299845 | 19/66 (29%) | ||
IG_like | 228..307 | CDD:214653 | 28/86 (33%) | ||
Ig | 235..305 | CDD:143165 | 25/70 (36%) | ||
FN3 | 312..415 | CDD:238020 | 3/4 (75%) | ||
Iglon5 | XP_218634.5 | Ig | 41..129 | CDD:416386 | 22/112 (20%) |
Ig strand A' | 41..46 | CDD:409353 | |||
Ig strand B | 48..56 | CDD:409353 | |||
CDR1 | 56..60 | CDD:409353 | 84/329 (26%) | ||
FR2 | 61..68 | CDD:409353 | 4/6 (67%) | ||
Ig strand C | 61..67 | CDD:409353 | 4/5 (80%) | ||
CDR2 | 69..79 | CDD:409353 | 1/14 (7%) | ||
Ig strand C' | 71..74 | CDD:409353 | 1/2 (50%) | ||
Ig strand C' | 76..79 | CDD:409353 | 0/7 (0%) | ||
FR3 | 80..115 | CDD:409353 | 13/73 (18%) | ||
Ig strand D | 84..91 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 94..100 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 107..115 | CDD:409353 | 3/17 (18%) | ||
CDR3 | 116..120 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 120..129 | CDD:409353 | 1/8 (13%) | ||
FR4 | 122..129 | CDD:409353 | 1/6 (17%) | ||
Ig strand A | 132..137 | CDD:409353 | 0/4 (0%) | ||
Ig_3 | 134..199 | CDD:404760 | 21/83 (25%) | ||
Ig strand A' | 140..145 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 148..157 | CDD:409353 | 2/8 (25%) | ||
Ig strand C | 163..167 | CDD:409353 | 3/20 (15%) | ||
Ig strand D | 174..177 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 178..183 | CDD:409353 | 1/4 (25%) | ||
Ig strand F | 191..199 | CDD:409353 | 4/9 (44%) | ||
Ig_3 | 217..295 | CDD:404760 | 26/80 (33%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 2/7 (29%) | ||
Ig strand B | 234..238 | CDD:409353 | 2/3 (67%) | ||
Ig strand C | 247..251 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 288..293 | CDD:409353 | 3/4 (75%) | ||
Ig strand G | 301..304 | CDD:409353 | 0/2 (0%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166337192 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |