DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Vsig10

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001258265.1 Gene:Vsig10 / 304529 RGDID:1565800 Length:564 Species:Rattus norvegicus


Alignment Length:393 Identity:78/393 - (19%)
Similarity:120/393 - (30%) Gaps:138/393 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AVAWANHHESL-----SLSPAEHSVVRYTNES---LIVQCRSPDPKVELHWKSPKGEIIREHKGR 71
            |||....||::     |||.:...|..|.|:|   .:|...|..|..     :|:..:  |..|.
  Rat    56 AVAIGEVHENVTLRCGSLSGSRGLVTWYRNDSEPAFLVSSNSSLPPA-----APRFSL--EDAGA 113

  Fly    72 IHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQ-------KITFT---ENAT 126
            :.||.            :.|.|.||::|.......|.....|.|..       .|:.|   .|.|
  Rat   114 LRIEA------------LRLEDDGNYTCREVLNETHWFPVQLRVTSGPAHIDVNISATGTLPNGT 166

  Fly   127 VMTVKEGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEYAC 191
            :...: |.:....|....:|.|.|.|...   ..:..::.....:.|:...:..:::|..|.|.|
  Rat   167 LYAAR-GSQVDFSCCSAAQPPPEVEWWIQ---THSSVSESLGKNLSANSFTLMLMSKNLQGNYTC 227

  Fly   192 RAYQVNSIASDMQERTVLMKIEHKP---------------------------------IWSKTP- 222
            .|   .::.|..|.:.....:.:.|                                 :|::.| 
  Rat   228 SA---TNVLSRRQRKVTTELLVYWPPPSAPQCSAGLSPESANLELTCNWDGGYPDPTFLWTEEPG 289

  Fly   223 -----------------------------------------------FVS--LKYAYINGTATLM 238
                                                           ..|  :|...:.|..||.
  Rat   290 GVVVGNSKLQTLSPSQLSEGKKFKCVGSHILGPESGASCVVQISSPLLASRPMKTCLVGGDVTLT 354

  Fly   239 CEAL-AEPPANFTWYRK----HNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFDN---YRCRARN 295
            |:.. |.|||...|.|.    ...:..::| |.|......||||||  |.|...:   |.|||.|
  Rat   355 CQVEGANPPARIQWLRNLTQPETAIQPSSR-YVITQQGQSSSLTIH--NCSQDQDGGFYFCRAEN 416

  Fly   296 DLG 298
            .:|
  Rat   417 PVG 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 19/84 (23%)
I-set 128..202 CDD:254352 12/73 (16%)
Ig 133..>193 CDD:299845 11/59 (19%)
IG_like 228..307 CDD:214653 27/79 (34%)
Ig 235..305 CDD:143165 26/72 (36%)
FN3 312..415 CDD:238020
Vsig10NP_001258265.1 Ig 60..146 CDD:299845 24/104 (23%)
IG_like 60..145 CDD:214653 24/103 (23%)
IG_like 165..246 CDD:214653 15/87 (17%)
Ig 175..241 CDD:143165 13/71 (18%)
Ig_3 255..318 CDD:290638 2/62 (3%)
IG_like 347..429 CDD:214653 27/76 (36%)
Ig 351..426 CDD:143165 26/72 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.