DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Lsamp

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus


Alignment Length:372 Identity:93/372 - (25%)
Similarity:163/372 - (43%) Gaps:53/372 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIGFILNLAALTAVA-WANHHESLSLSP----------------AEHSVVRYTNESLIVQCRSPD 50
            ::||.|:|.:|..:| |......::|||                .::..|| ..::.|::|...|
  Rat    11 VLGFFLSLFSLQVLAFWNQPPAEVNLSPITIPGLPVRSVDFNRGTDNITVR-QGDTAILRCVVED 74

  Fly    51 PKVELHWKSPKGEIIREH-----KGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLH--- 107
            ...::.|.:..|.|...|     ..|:.:|:....:..:....:.:.|:|:::|...  :.|   
  Rat    75 KNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHALEYSLRIQKVDVYDEGSYTCSVQ--TQHEPK 137

  Fly   108 SKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNVTW-HFNGQPISAGAADDSKFRI 171
            :....|||......:..::.:||.||...|::|...|.|:|.:|| |..  |:......:.::  
  Rat   138 TSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLT--PLGREFEGEEEY-- 198

  Fly   172 LADGLLINKVTQNDTGEYACRAYQVNSIAS-DMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTA 235
                |.|..:|:..:|:|.|:|  .|.::| |:::  |.:.:.:.|..:::   ....|.....|
  Rat   199 ----LEILGITREQSGKYECKA--ANEVSSADVKQ--VKVTVNYPPTITES---KSNEATTGRQA 252

  Fly   236 TLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTI 300
            :|.|||.|.|..:|.|||...:::|.|.| .|:|....||||:..:....:.||.|.|.|.||..
  Rat   253 SLKCEASAVPAPDFEWYRDDTRINSANGL-EIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVT 316

  Fly   301 ERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRGPPDSPMGVNG 347
            ..:..|.:...|..|...|..|      ..|....:| |.|..|:||
  Rat   317 NASLVLFKRVLPTVPHPIQEIG------TTVHFKQKG-PGSVRGING 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 16/89 (18%)
I-set 128..202 CDD:254352 22/75 (29%)
Ig 133..>193 CDD:299845 16/60 (27%)
IG_like 228..307 CDD:214653 28/78 (36%)
Ig 235..305 CDD:143165 27/69 (39%)
FN3 312..415 CDD:238020 11/36 (31%)
LsampXP_038944182.1 Ig 55..145 CDD:416386 16/92 (17%)
FR1 55..71 CDD:409353 3/16 (19%)
Ig strand A' 56..62 CDD:409353 2/6 (33%)
Ig strand B 64..72 CDD:409353 2/7 (29%)
CDR1 72..76 CDD:409353 1/3 (33%)
FR2 77..84 CDD:409353 1/6 (17%)
Ig strand C 77..83 CDD:409353 1/5 (20%)
CDR2 85..95 CDD:409353 3/9 (33%)
Ig strand C' 87..90 CDD:409353 1/2 (50%)
Ig strand C' 92..95 CDD:409353 1/2 (50%)
FR3 96..131 CDD:409353 5/34 (15%)
Ig strand D 100..107 CDD:409353 2/6 (33%)
Ig strand E 110..116 CDD:409353 0/5 (0%)
Ig strand F 123..131 CDD:409353 2/7 (29%)
CDR3 132..136 CDD:409353 1/3 (33%)
Ig strand G 136..145 CDD:409353 1/8 (13%)
FR4 138..145 CDD:409353 1/6 (17%)
Ig_3 148..218 CDD:404760 20/79 (25%)
Ig strand A' 155..160 CDD:409353 0/4 (0%)
Ig strand B 166..173 CDD:409353 2/6 (33%)
Ig strand C 179..184 CDD:409353 2/4 (50%)
Ig strand D 190..193 CDD:409353 0/2 (0%)
Ig strand E 197..203 CDD:409353 2/11 (18%)
Ig strand F 210..217 CDD:409353 4/8 (50%)
Ig strand G 224..232 CDD:409353 2/9 (22%)
Ig_3 235..311 CDD:404760 26/79 (33%)
Ig strand B 252..256 CDD:409353 2/3 (67%)
Ig strand C 265..269 CDD:409353 1/3 (33%)
Ig strand E 290..294 CDD:409353 3/3 (100%)
Ig strand F 304..309 CDD:409353 3/4 (75%)
Ig strand G 318..321 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337165
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.