DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and dpr1

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:253 Identity:55/253 - (21%)
Similarity:88/253 - (34%) Gaps:90/253 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 MTVKEGEKATILCEVKGEPQPNVTW------HFNGQPISAGA---ADDSKFRIL-ADG-----LL 177
            :||..|:...:.|.|:.....:|:|      |.    ::||.   ..|.:|::| .||     |.
  Fly    63 LTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHI----LTAGGTTYTSDQRFQVLRPDGSANWTLQ 123

  Fly   178 INKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAY--------INGT 234
            |......|:|.|.|   |:|:                      .|.:||.|.:        |.|.
  Fly   124 IKYPQPRDSGVYEC---QINT----------------------EPKMSLSYTFNVVELKAEIFGP 163

  Fly   235 ATLM----------CEALAEPP--ANFTWY--------RKHNKLHSNNRLYTIQSDSYW-----S 274
            :.||          |:.:..|.  .|..||        :..|::.|:.....::.|  |     |
  Fly   164 SDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDD--WTDGLTS 226

  Fly   275 SLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQ----GEKPPSPANFQLRGFNSNTF 328
            .|.|.........||.|     :.|:.:|:.:..    ||.|.:..:..  ..|||:|
  Fly   227 RLKIKRAMPGDTGNYTC-----VPTVAKTSSVYVHVIIGEHPAAMQHNS--SSNSNSF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653
I-set 128..202 CDD:254352 23/88 (26%)
Ig 133..>193 CDD:299845 19/74 (26%)
IG_like 228..307 CDD:214653 22/111 (20%)
Ig 235..305 CDD:143165 19/94 (20%)
FN3 312..415 CDD:238020 5/17 (29%)
dpr1NP_001286645.1 Ig 59..154 CDD:299845 27/119 (23%)
IG_like 60..150 CDD:214653 26/115 (23%)
IG_like 163..257 CDD:214653 19/100 (19%)
Ig 174..244 CDD:143165 15/76 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.