DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Cntn4

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001103219.1 Gene:Cntn4 / 269784 MGIID:1095737 Length:1026 Species:Mus musculus


Alignment Length:481 Identity:94/481 - (19%)
Similarity:155/481 - (32%) Gaps:137/481 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DPKVELHWKSPKGEII----REHKGRIHIEQTSTEQLKIVFAHIALADKGNWSC--EAADGSLHS 108
            :|...:.|:...|:.|    |.||....:|..:.:|          .|.|::.|  |.:.|...:
Mouse   252 NPVPTILWRRADGKPIARKARRHKSNGILEIPNFQQ----------EDAGSYECVAENSRGKNVA 306

  Fly   109 KSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILA 173
            |. .|..|.:..:.:....:.|...|.....|:..|.|:|...|..||.|:    ....:.:|..
Mouse   307 KG-QLTFY
AQPNWVQIINDIHVAMEESVFWECKANGRPKPTYRWLKNGDPL----LTRDRIQIEQ 366

  Fly   174 DGLLINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLM 238
            ..|.|..|..:|.|.|.|.|...:.:.....|.:|   |...|.:|:|....:....:.|...:.
Mouse   367 GTLNITIVNLSDAGMYQCVAENKHGVIFSSAELSV
---IAESPDFSRTLLKRVTLVKVGGEVVIE 428

  Fly   239 CEALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFD--NYRCRARNDLGTIE 301
            |:..|.|...:||.:....|..|.|: ||..|.     .:.::|.:..|  :|.|.|.|..||..
Mouse   429 CKPKASPRPVYTWRKGREILRENERI-TISEDG-----NLRIINVTKSDAGSYTCIATNHFGTAS 487

  Fly   302 RTTRLEQGEK-----PPSP---------------------------------------------- 315
            .|..:...:.     |||.                                              
Mouse   488 STGNVIV
KDPTKVMVPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWTFNGHLIDFDKDGDHFERV 552

  Fly   316 -----------ANFQLRGFN-------------SNTFDVVLSAPRGPPDSPMGVNGFRIEYMTE- 355
                       .|.||:...             |...|:::..|.|||::      ..|:.:|: 
Mouse   553 GGQDSAGDLMIRNIQLKHAGKYVCMVQTSVDKLSVAADLIVRGPPGPPEA------VTIDEITDT 611

  Fly   356 -MEFKTDAGKWTNARRKDYAFE-------------------EGATFLLT--NLEPDTVYLVRAAS 398
             .:.....|...::....|..:                   :|.||..|  .|.|...|..|..:
Mouse   612 TAQLSWRPGPDNHSPITMYVIQARTPFSVGWQAVNTVPDLVDGKTFTATVVGLNPWVEYEFRTVA 676

  Fly   399 RNLAGFSDFTK-VEKYKTLSLEPRVS 423
            .|:.|..:.:: .||.:|....|.|:
Mouse   677 ANVIGIGEPSRPSEKRRTEEALPEVT 702

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 16/70 (23%)
I-set 128..202 CDD:254352 19/73 (26%)
Ig 133..>193 CDD:299845 17/59 (29%)
IG_like 228..307 CDD:214653 21/80 (26%)
Ig 235..305 CDD:143165 20/71 (28%)
FN3 312..415 CDD:238020 28/196 (14%)
Cntn4NP_001103219.1 Ig 25..118 CDD:386229
Ig 120..213 CDD:386229
Ig 225..313 CDD:386229 16/71 (23%)
Ig 318..401 CDD:386229 20/86 (23%)
Ig 422..494 CDD:386229 21/77 (27%)
Ig6_Contactin-4 513..597 CDD:143261 5/83 (6%)
FN3 597..690 CDD:238020 17/98 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..710 5/18 (28%)
FN3 703..792 CDD:238020 94/481 (20%)
FN3 804..896 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 886..906
FN3 904..989 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.