DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and DIP-lambda

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster


Alignment Length:379 Identity:92/379 - (24%)
Similarity:143/379 - (37%) Gaps:63/379 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 W-KSPKGEIIREH------KGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKS--FD 112
            | ||....|:..|      ..|:.:........|:..:.:.:.|.|::.|:.....:.|.|  .|
  Fly    83 WIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRVQINDSGSYMCQVNTDPMKSLSGYLD 147

  Fly   113 LIVYQKITF--TENATVMTVKEGEKATILCEVKGEPQPNVTWHFN-GQPI--SAGAADDSKFR-I 171
            ::|...|..  ..|......:||...:::|.|.|.|:|.|.|... |:.|  .....|.:.|: :
  Fly   148 VVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREAGKEIILRTDGRDKTGFKSV 212

  Fly   172 LADGLLINKVTQNDTGEYACRAYQVNSIASDMQER-TVLMKIEHKPIWSKTPFV----SLKYAYI 231
            ..:.|::..|.::|.|.|.|.|  .|.|...:.:| .|.:..        :|.|    .|..|.:
  Fly   213 EGERLVLTNVQRSDMGGYNCIA--SNGIPPSVSKRFNVYVNF--------SPTVKAISQLVGAPV 267

  Fly   232 NGTATLMCEALAEPPANFTWYRKHN--KLHSNNRLYTIQSD-----SYWSSLTIHVLNTSAFDNY 289
            ....||.|.....|.....|||...  |||:.|: |.|..:     ::..:|||..|..|.|..|
  Fly   268 EREVTLECIVEVFPKPLNGWYRSEGNIKLHNGNK-YNISEEVINIYTWHLNLTIRHLTKSDFGTY 331

  Fly   290 RCRARNDLGTIERTTRLEQGEKPP----SPA-NFQLRGFNSNTFDVVLSAPRGPPDSPMGVN--- 346
            .|.:.|.||..|...||::...||    :|. :.|..|         .|..:.|.....|:|   
  Fly   332 SCSSVNALGKSESLIRLQELRLPPKLTTTPTPHMQTTG---------KSRRKHPASHKKGLNEVL 387

  Fly   347 -----GFRIEYMTEMEFKT---DAGKWTNARRKDYAFEEGATFLLTNLEPDTVY 392
                 .|..:...|.|...   |..|:||:...:...|.|....:.|.|...:|
  Fly   388 RFQETHFANQIQQENEDHNEGFDLLKFTNSENSNIVLESGHINSMINKEDVNIY 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 13/66 (20%)
I-set 128..202 CDD:254352 22/77 (29%)
Ig 133..>193 CDD:299845 18/63 (29%)
IG_like 228..307 CDD:214653 27/85 (32%)
Ig 235..305 CDD:143165 25/76 (33%)
FN3 312..415 CDD:238020 21/97 (22%)
DIP-lambdaNP_001334747.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.