DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and NEGR1

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:339 Identity:80/339 - (23%)
Similarity:130/339 - (38%) Gaps:81/339 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LIVQCRSPDPKVELHWKSPKGEIIREHKG-----RIHIEQTSTEQLKIVFAHIALADKGNWSCE- 100
            |:..|......|:..|.:....::|  ||     |.::|..:::...:..:.|..|....||.: 
Human    27 LLPSCLPAGQSVDFPWAAVDNMMVR--KGDTAVLRCYLEDGASKGAWLNRSSIIFAGGDKWSVDP 89

  Fly   101 -AADGSLHSKSFDLIVYQKITFTENA-------------------TV------------MTVKEG 133
             .:..:|:.:.:.|.: |.:..|::.                   ||            |||.||
Human    90 RVSISTLNKRDYSLQI-QNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEG 153

  Fly   134 EKATILCEVKGEPQPNVTWHF---NGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRAYQ 195
            ...|:.|...|:|:|:::|..   :.:|...|...|           |..:|::..|||.|.|  
Human   154 TNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLD-----------IYGITRDQAGEYECSA-- 205

  Fly   196 VNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTAT------LMCEALAEPPANFTWYRK 254
             .:..|....|.|.:.:...|...:..         :||.|      :.||....||..|.||:.
Human   206 -ENDVSFPDVRKVKVVVNFAPTIQEIK---------SGTVTPGRSGLIRCEGAGVPPPAFEWYKG 260

  Fly   255 HNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQ 319
            ..||.:..:...||:.|..|.||:..:....|.||.|.|.|.|||...:..|    .|||.|.:.
Human   261 EKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPL----NPPSTAQYG 321

  Fly   320 LRGFNSNTFDVVLS 333
            :.|    :.||:.|
Human   322 ITG----SADVLFS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 15/79 (19%)
I-set 128..202 CDD:254352 21/76 (28%)
Ig 133..>193 CDD:299845 16/62 (26%)
IG_like 228..307 CDD:214653 27/84 (32%)
Ig 235..305 CDD:143165 25/75 (33%)
FN3 312..415 CDD:238020 8/22 (36%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 13/90 (14%)
IGc2 152..210 CDD:197706 18/71 (25%)
Ig_3 225..301 CDD:372822 24/84 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143446
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.