DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and IGSF9B

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:435 Identity:96/435 - (22%)
Similarity:160/435 - (36%) Gaps:92/435 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LSPAEHSVVRYTNESLIVQCRSPDPKVEL----HWKSPKGEIIREHKGRIHIEQTSTEQLKIVFA 87
            :||.|:..|..:.::|:. ||:......|    :|:........:.|.|:.|....|    ::..
Human   232 VSPPENITVNISQDALLT-CRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDGT----LIIF 291

  Fly    88 HIALADKGNWSCEAAD--GSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNV 150
            .:...|.|.::|..::  |...|.|..|.|...........|:.|..|....|.|.|..||...|
Human   292 RVKPEDSGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATV 356

  Fly   151 T-WHFNGQPISAGAADDSKFRILADG-LLINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIE 213
            . |:.:|:|:.  ...:..:.::.|| :.|.:.|:...|.|.|..|  |::.:..|.....:.::
Human   357 VKWNKDGRPLQ--VEKNLGWTLMEDGSIRIEEATEEALGTYTCVPY--NTLGTMGQSAPARLVLK 417

  Fly   214 HKPIWSKTPFVSLKYAYINGTATLM-CEALAEPPANFTWYR-------KHNKLHSNNRLYTIQSD 270
            ..|.::..|  ..:|....|...|: |.|..:|....||.:       ||:.|.|          
Human   418 DPPYFTVLP--GWEYRQEAGRELLIPCAAAGDPFPVITWRKVGKPSRSKHSALPS---------- 470

  Fly   271 SYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQ-GEKPPSPANFQLR------------- 321
               .||....|:......:.|.|.|.:.:|..:|.|.. |..|.:|.:.:::             
Human   471 ---GSLQFRALSKEDHGEWECVATNVVTSITASTHLTVIGTSPHAPGSVRVQVSMTTANVSWEPG 532

  Fly   322 --GFNSNTFDVVLS-APRGPPDSPMGVNGFRIEYMTEMEFKTDAGKWTNARRKDYAFEEGATFLL 383
              |....||.|.:. |..||.|                        |.:     .....|.::||
Human   533 YDGGYEQTFSVWMKRAQFGPHD------------------------WLS-----LPVPPGPSWLL 568

  Fly   384 TN-LEPDTVYLVRAASRNLAGFSDFTKVEKYKTLSL-----EPRV 422
            .: |||:|.|.....::|..|.|.|::|....||:.     ||.|
Human   569 VDTLEPETAYQFSVLAQNKLGTSAFSEVVTVNTLAFPITTPEPLV 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 17/87 (20%)
I-set 128..202 CDD:254352 20/75 (27%)
Ig 133..>193 CDD:299845 17/61 (28%)
IG_like 228..307 CDD:214653 20/86 (23%)
Ig 235..305 CDD:143165 17/77 (22%)
FN3 312..415 CDD:238020 24/119 (20%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653
Ig 41..115 CDD:143165
I-set 139..225 CDD:254352
IGc2 153..210 CDD:197706
I-set 229..321 CDD:254352 20/93 (22%)
Ig 235..321 CDD:299845 18/90 (20%)
IG_like 331..414 CDD:214653 22/86 (26%)
Ig <353..414 CDD:299845 14/64 (22%)
IG_like 426..505 CDD:214653 22/93 (24%)
Ig 442..505 CDD:299845 18/75 (24%)
FN3 510..601 CDD:238020 24/119 (20%)
FN3 617..699 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.