DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and zig-6

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_508882.3 Gene:zig-6 / 192089 WormBaseID:WBGene00006983 Length:243 Species:Caenorhabditis elegans


Alignment Length:279 Identity:59/279 - (21%)
Similarity:110/279 - (39%) Gaps:56/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RLIGFILNLAALTAVAWANHHESLSLSPAEHSVVRYTNESLIVQCR-----SPDPKVELHWKSPK 61
            :|...:|.|..|.:.::|....::|:||..:.|.:.....:.:.|.     |...|..:.||...
 Worm     3 KLCLLLLPLVFLVSYSFAEEEITISISPNANPVQKPIGHQISLVCSIKKTDSNGEKPGMIWKKHG 67

  Fly    62 GEIIREHKGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGS-LHSKSFDLIVYQKITFTEN- 124
            |   .:..|.:.:::.....|.::..:.::.|.|.:.|:|..|| ::....|:||::.|.|.:. 
 Worm    68 G---LDRTGNVEVKKLDDYTLGLIIRNSSVEDSGVYYCQAQVGSKVYMNKMDVIVFEDIVFRDKQ 129

  Fly   125 -------ATVMTVKEGEKATILCEVKGEPQPNVT-WHFNGQPISAGAADDSKFRILADGLLI--- 178
                   ||.       ...|.|||..:....:| |..:|:.|..|    .|.:..:.|.::   
 Worm   130 LHFGQVLATA-------SVNISCEVSAKKDSVITYWTRHGKQILEG----GKHKFYSRGSILEIQ 183

  Fly   179 NKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALA 243
            |...:.|.|:|.|..:.|:|.:|:.:..|:....|..              |:  ....||.:..
 Worm   184 NYQPEQDAGQYTCEVFHVSSGSSNTKTVTLGTTGEKN--------------YV--ACQQMCNSFC 232

  Fly   244 EPPANFTWYRKHNKLHSNN 262
            ..        .|||:.:||
 Worm   233 TD--------VHNKVFTNN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 16/87 (18%)
I-set 128..202 CDD:254352 18/77 (23%)
Ig 133..>193 CDD:299845 16/63 (25%)
IG_like 228..307 CDD:214653 8/35 (23%)
Ig 235..305 CDD:143165 7/28 (25%)
FN3 312..415 CDD:238020
zig-6NP_508882.3 IG_like 34..119 CDD:214653 16/87 (18%)
Ig 45..109 CDD:299845 13/66 (20%)
IG_like 135..213 CDD:214653 21/88 (24%)
ig 140..213 CDD:278476 19/76 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.