DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and zig-2

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:242 Identity:57/242 - (23%)
Similarity:86/242 - (35%) Gaps:56/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SCEAADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNVTWHFNGQPISAG 162
            :.|:.|.....::.|.....|.|.|.|.:.:|.  |||..:.|...|.|.|::.|..||..|...
 Worm    14 AAESVDHQKPIRALDSQPLLKFTRTPNDSNVTF--GEKFVLSCGANGAPLPSIYWELNGMRIQGE 76

  Fly   163 AADDSKFRILADGLLINK------------VTQNDTGEYACRAYQVNSIASDMQERTVLMKIEH- 214
            ...:....||.||..::.            .|..::|.|.|       |..:     .|.|:|| 
 Worm    77 ETSNVYENILNDGKQVSNAAMVSSHYRIPCATARNSGAYKC-------IIDN-----GLTKLEHV 129

  Fly   215 KPIW---SKT---------PFVSL----KYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNR 263
            ..::   :||         ||:|:    :....|....|.|.  :|....::|       |...:
 Worm   130 AKVFVGGNKTNCALNDNGAPFISMTVDFRLEISNNAVALSCR--SETATEWSW-------HKGEQ 185

  Fly   264 LYTIQSDSYW----SSLTIHVLNTSAFDNYRCRARNDLGTIERTTRL 306
            |.|...:.|.    ..|.|..::.|....|.|.|||..|.....|.|
 Worm   186 LLTNDGERYQMFPSGDLIIRNISWSDMGEYNCTARNHFGETTAITFL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 3/16 (19%)
I-set 128..202 CDD:254352 21/85 (25%)
Ig 133..>193 CDD:299845 19/71 (27%)
IG_like 228..307 CDD:214653 20/83 (24%)
Ig 235..305 CDD:143165 17/73 (23%)
FN3 312..415 CDD:238020
zig-2NP_510069.1 I-set 34..134 CDD:254352 29/113 (26%)
Ig 34..121 CDD:299845 25/95 (26%)
Ig <179..232 CDD:299845 15/59 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.