DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and DSCAM

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens


Alignment Length:468 Identity:110/468 - (23%)
Similarity:195/468 - (41%) Gaps:109/468 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LSLSPAEHSVVRY-------------TNESLIVQC--RSPDPKVELHWKSPKGEIIREHKGRIHI 74
            ||.|.:.|..|:.             ..:.:.:.|  .|.|..:.:.|:. .|..|....| :.|
Human   583 LSTSQSVHVTVKVPPFIQPFEFPRFSIGQRVFIPCVVVSGDLPITITWQK-DGRPIPGSLG-VTI 645

  Fly    75 EQTS-TEQLKIVFAHIALADKGNWSC----EAADGSLHSKSFDLIVYQKITFTENATVMTVKEGE 134
            :... |..|:|  ::::|...||::|    |||.....|:   |||.....|     |:..::.:
Human   646 DNIDFTSSLRI--SNLSLMHNGNYTCIARNEAAAVEHQSQ---LIVRVPPKF-----VVQPRDQD 700

  Fly   135 ----KATIL-CEVKGEPQPNVTWHFN---GQPISAGAADDSKFRILADG-LLINKVTQNDTGEYA 190
                ||.|| |..:|.|.|.:.|.|:   |.|.....|.:.:.::|::| |||..|.:.|:|.|.
Human   701 GIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYL 765

  Fly   191 CRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKY-----AYINGT-AT------LMCEALA 243
            |:.  .|.:.:|:               ||:.::::|.     :|.|.| ||      :.|.|..
Human   766 CKV--SNDVGADV---------------SKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHG 813

  Fly   244 EPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSL--TIHVLNTSAFDN--YRCRARN----DLGTI 300
            |.|....|.::...::.....|.:.:......:  |:.:|.|...|:  :.|.|.|    |.|.|
Human   814 EKPIIVRWEKEDRIINPEMARYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGEDRGII 878

  Fly   301 ERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRG-PPDSPMGVNGFRIEYMTEMEFKTDAGK 364
            :.|.     ::||.|...:::...:.|  :.|....| ..:||  :.|:      ::|.|..:..
Human   879 QLTV-----QEPPDPPEIEIKDVKART--ITLRWTMGFDGNSP--ITGY------DIECKNKSDS 928

  Fly   365 WTNARR-KDYAFE-EGATFLLTNLEPDTVYLVRAASRNLAGFSD------FTKVEKY-----KTL 416
            |.:|:| ||.:.: ..||.:  ::.|.:.|.:|..::|..|.|:      .|..|..     :.:
Human   929 WDSAQRTKDVSPQLNSATII--DIHPSSTYSIRMYAKNRIGKSEPSNELTITADEAAPDGPPQEV 991

  Fly   417 SLEPRVSSGVKET 429
            .|||..|..::.|
Human   992 HLEPISSQSIRVT 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 21/101 (21%)
I-set 128..202 CDD:254352 24/82 (29%)
Ig 133..>193 CDD:299845 23/68 (34%)
IG_like 228..307 CDD:214653 22/98 (22%)
Ig 235..305 CDD:143165 19/83 (23%)
FN3 312..415 CDD:238020 26/116 (22%)
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352
I-set 315..385 CDD:333254
Ig_3 407..488 CDD:316449
IGc2 518..575 CDD:197706
I-set 596..686 CDD:333254 20/96 (21%)
Ig_DSCAM 707..784 CDD:143211 25/93 (27%)
Ig 802..889 CDD:325142 19/91 (21%)
FN3 885..978 CDD:238020 24/104 (23%)
FN3 986..1083 CDD:238020 5/19 (26%)
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.