DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and syg-2

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001309674.1 Gene:syg-2 / 181561 WormBaseID:WBGene00007750 Length:1230 Species:Caenorhabditis elegans


Alignment Length:385 Identity:95/385 - (24%)
Similarity:157/385 - (40%) Gaps:72/385 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SPAEHSVVRYTNESLIVQC---RSPDPKVELHWKSPKGE--------IIREHKGRIHIEQTSTEQ 81
            ||:..|.:  ..||:..:|   :||:|.|...|||..|.        |:..|:||....:.:.|:
 Worm    24 SPSNLSTI--AGESITFRCSAEKSPEPIVYSQWKSNTGSLLGYHQEGILPGHQGRFSYIKQNAEE 86

  Fly    82 LKIVFAHIALADKGNWSCE---AADGSLHSKSF-DLIVYQKITFTEN---ATVMTVKEGEKATIL 139
            |.:...|:.|.|.|.:.|:   ..:|.:.:||| ::||..::.:..|   .:::.|||.....|.
 Worm    87 LHLKITHVNLDDDGEYECQMLHPEEGPIRAKSFLNIIVPPQLVYFSNYQPNSIIAVKENTPLNIT 151

  Fly   140 CEVKG-EPQPNVTWHFNGQPISAGAADDS------KFRILADGLLINKVTQNDTGE-YACRAYQV 196
            |.|.. :|:|.|.|:.:|:.:|......|      .|.:...  |:.:..:||.|: ..|.|:|.
 Worm   152 CVVPNVKPEPEVLWYMDGKVMSRDVKQASTPHLNKTFTVYTS--LVVQSDRNDHGKVITCEAFQK 214

  Fly   197 NSIASDMQERT-VLMKIEHKPIWSKTPFVSLKYAYING-TATLMCEAL-AEPPANFTWYRKHNKL 258
            .   :|::..| ..:.:...|.......:....|..:| ..|:.|... ..||.:..||.::.:|
 Worm   215 E---TDIRITTNTTLDVLFPPSDPTVEILRNPSALRSGDNVTIACSVTGGNPPPDVFWYHENKRL 276

  Fly   259 HSNNRLYTIQSDSYWSSLTIHVLNTSAFDN---YRCRARND-LGTIERTTRLEQGEKPP------ 313
            .|::.|.|...:    ...|:....|..||   |.|||.|. .|..:|.....:...||      
 Worm   277 QSHSTLDTRSKE----IKNIYSFIASQNDNMAEYECRANNSRTGNPKRKAMKLEVNYPPASVELF 337

  Fly   314 --------SPANFQLRGFNSNTFDVVLSAPRGPPDSPMG--VNGFRIEYMTEMEFKTDAG 363
                    |.||.|.:...||            |.|.:.  :||..:...|:.||..:.|
 Worm   338 GESNIRYGSSANIQCKSLPSN------------PASQITWIINGRSVPTPTQREFVVENG 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 27/96 (28%)
IgI_Twitchin_like 120..208 CDD:409541 24/99 (24%)
Ig strand A 120..123 CDD:409541 0/2 (0%)
Ig strand A' 127..131 CDD:409541 0/3 (0%)
Ig strand B 134..141 CDD:409541 1/6 (17%)
Ig strand C 149..154 CDD:409541 2/4 (50%)
Ig strand C' 156..159 CDD:409541 1/2 (50%)
Ig strand D 165..170 CDD:409541 1/10 (10%)
Ig strand E 173..178 CDD:409541 0/4 (0%)
Ig strand F 187..195 CDD:409541 3/8 (38%)
Ig strand G 198..208 CDD:409541 2/10 (20%)
IG_like 228..307 CDD:214653 23/84 (27%)
Ig strand B 235..239 CDD:409353 1/3 (33%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 0/3 (0%)
Ig strand F 288..293 CDD:409353 3/7 (43%)
FN3 312..415 CDD:238020 16/68 (24%)
syg-2NP_001309674.1 IG_like 25..105 CDD:214653 23/81 (28%)
Ig strand B 36..40 CDD:409353 0/3 (0%)
Ig strand C 49..55 CDD:409353 1/5 (20%)
Ig strand E 83..91 CDD:409353 2/7 (29%)
Ig strand F 101..105 CDD:409353 0/3 (0%)
Ig 139..228 CDD:472250 23/93 (25%)
Ig strand B 148..152 CDD:409353 1/3 (33%)
Ig strand C 162..166 CDD:409353 1/3 (33%)
Ig strand E 192..196 CDD:409353 1/5 (20%)
Ig strand F 206..211 CDD:409353 1/4 (25%)
Ig strand G 221..224 CDD:409353 1/2 (50%)
Ig_3 235..312 CDD:464046 20/80 (25%)
Ig 430..537 CDD:472250
Ig strand B 450..454 CDD:409353
Ig strand C 464..468 CDD:409353
Ig strand E 501..505 CDD:409353
Ig strand F 515..520 CDD:409353
Ig strand G 530..533 CDD:409353
Ig 540..635 CDD:472250
Ig strand B 562..566 CDD:409353
Ig strand C 576..585 CDD:409353
Ig strand E 610..614 CDD:409353
Ig strand F 624..629 CDD:409353
Ig 657..738 CDD:472250
Ig strand B 668..672 CDD:409353
Ig strand C 682..686 CDD:409353
Ig strand F 718..723 CDD:409353
Ig strand G 731..734 CDD:409353
Ig_3 743..814 CDD:464046
Ig 848..922 CDD:472250
Ig strand B 851..855 CDD:409353
Ig strand C 865..868 CDD:409353
Ig strand E 895..899 CDD:409353
Ig strand F 910..915 CDD:409353
FN3 934..1023 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.