DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Ncam2

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001106679.1 Gene:Ncam2 / 17968 MGIID:97282 Length:837 Species:Mus musculus


Alignment Length:495 Identity:114/495 - (23%)
Similarity:201/495 - (40%) Gaps:117/495 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AVAWANHHESLSLSPAEHSVVRYTN---------------------------------------- 39
            ||:|..|:|.::..|.....|...|                                        
Mouse   145 AVSWLYHNEEVTTIPDNRFAVLANNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPP 209

  Fly    40 ----------------ESLIVQCR---SPDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQLKIV 85
                            |.:.:.|:   ||||.:.  | ...|::|.|::..| ::.::||   :.
Mouse   210 AIMMPQKSFNATAERGEEMTLTCKASGSPDPTIS--W-FRNGKLIEENEKYI-LKGSNTE---LT 267

  Fly    86 FAHIALADKGNWSCEAAD--GSLHSKSF-DLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQ 147
            ..:|...|.|::.|:|.:  |....::| .:.|...|...:|.   |..|....|::||.:|||.
Mouse   268 VRNIINKDGGSYVCKATNKAGEDQKQAFLQVFVQPHILQLKNE---TTSENGHVTLVCEAEGEPV 329

  Fly   148 PNVTWH--FNGQPISAG-AADDSKFRILA----DGLLINKVTQNDTGEYACRAYQVNSIASDM-- 203
            |.:||.  .:|...|.| .:.|.:..:..    ..|.|..|..:|:|.|.|.|      ||.:  
Mouse   330 PEITWKRAIDGVMFSEGDKSPDGRIEVKGQHGRSSLHIRDVKLSDSGRYDCEA------ASRIGG 388

  Fly   204 QERTVLMKIEHKPIWSKTPFVS---LKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLY 265
            .:|::.:.||:.|     .|||   :.|::......:.|:..|.|||:..|.|:...|.:.|..:
Mouse   389 HQRSMHLDIEYAP-----KFVSNQTMYYSWEGNPINISCDVTANPPASIHWRREKLLLPAKNTTH 448

  Fly   266 TIQSDSYWSSLTIHVLNTS--AFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTF 328
             :::.|....:.:.:..||  .|..|.|.|.|.:||..:...||..:.|.||...::...:..|.
Mouse   449 -LKTHSVGRKMILEIAPTSDNDFGRYNCTATNRIGTRFQEYILELADVPSSPHGVKIIELSQTTA 512

  Fly   329 DVVLSAPRGPPDSPMGVNGFRIEYMTEMEFKTDAGKWTNARRKDYAFEEGATFLLTNLEPDTVYL 393
            .:..:.|......|  ::.:::: :.|:..:|    |...|.....    ...:|::|||:|.|.
Mouse   513 KISFNKPESHGGVP--IHHYQVD-VKEVASET----WKIVRSHGVQ----TMVVLSSLEPNTTYE 566

  Fly   394 VRAASRNLAGFSDFTKVEKYKTL--------SLEPRVSSG 425
            :|.|:.|..|..|::|:|.::||        |:..:.|||
Mouse   567 IRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIHGQPSSG 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 22/143 (15%)
I-set 128..202 CDD:254352 24/80 (30%)
Ig 133..>193 CDD:299845 20/66 (30%)
IG_like 228..307 CDD:214653 20/80 (25%)
Ig 235..305 CDD:143165 19/71 (27%)
FN3 312..415 CDD:238020 23/102 (23%)
Ncam2NP_001106679.1 Ig1_NCAM-2 21..112 CDD:143274
I-set 22..111 CDD:254352
I-set 117..193 CDD:254352 8/47 (17%)
IGc2 128..189 CDD:197706 8/43 (19%)
Ig 208..301 CDD:299845 20/99 (20%)
I-set 215..298 CDD:254352 20/89 (22%)
Ig 300..397 CDD:299845 29/105 (28%)
IG_like 308..395 CDD:214653 27/95 (28%)
IG_like 413..491 CDD:214653 19/78 (24%)
IGc2 414..482 CDD:197706 17/68 (25%)
FN3 496..588 CDD:238020 23/102 (23%)
fn3 594..678 CDD:278470 4/13 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11169
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.