DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Ncam1

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:423 Identity:113/423 - (26%)
Similarity:181/423 - (42%) Gaps:69/423 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AEHSVVRYT---NESLIVQCRS---PDPKVELHWKSPKGEII--REHKGRIHIEQTSTEQLKIVF 86
            |..|:|..|   .:|:.:.|.:   |:|  .:.| :..||.|  .|.....||....:.:|.|  
Mouse   216 ARQSIVNATANLGQSVTLVCDADGFPEP--TMSW-TKDGEPIENEEEDDEKHIFSDDSSELTI-- 275

  Fly    87 AHIALADKGNWSCEA------ADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGE 145
            .::...|:..:.|.|      .|.|:|.|.|   ...|||:.||.|.|.::  |:.|:.||..|:
Mouse   276 RNVDKNDEAEYVCIAENKAGEQDASIHLKVF---AKPKITYVENQTAMELE--EQVTLTCEASGD 335

  Fly   146 PQPNVTWHFNGQPIS----AGAADDSKFRILADG------------LLINKVTQNDTGEYACRAY 194
            |.|::||..:.:.||    |......|...| ||            |.:..:...|.|||.|.| 
Mouse   336 PIPSITWRTSTRNISSEEKASWTRPEKQETL-DGHMVVRSHARVSSLTLKSIQYTDAGEYICTA- 398

  Fly   195 QVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKL- 258
             .|:|..|.|  ::.:::::.|   |.......|.:......:.||..|.|.|..:|:|....| 
Mouse   399 -SNTIGQDSQ--SMYLEVQYAP---KLQGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLP 457

  Fly   259 ---HSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQL 320
               :||.::|...|.||   |.:...:.:.|.||.|.|.|.:|.......|.|.:.|.||:..::
Mouse   458 SSNYSNIKIYNTPSASY---LEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDRV 519

  Fly   321 RGFNSNTFDVVLSAPRGPPDSPMGVNGFRIEYMTEMEFKTDAG---KWTNARRKDYAFEEGATFL 382
            ..: |:|..|....|......|:      ::|..|.:...:..   ||.:|:.   |..||...:
Mouse   520 EPY-SSTAQVQFDEPEATGGVPI------LKYKAEWKSLGEESWHFKWYDAKE---ANMEGIVTI 574

  Fly   383 LTNLEPDTVYLVRAASRNLAGFSDFTKVEKYKT 415
            : .|:|:|.|.||.|:.|..|..:.:...::||
Mouse   575 M-GLKPETRYSVRLAALNGKGLGEISAATEFKT 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 24/95 (25%)
I-set 128..202 CDD:254352 26/89 (29%)
Ig 133..>193 CDD:299845 22/75 (29%)
IG_like 228..307 CDD:214653 23/82 (28%)
Ig 235..305 CDD:143165 22/73 (30%)
FN3 312..415 CDD:238020 25/105 (24%)
Ncam1XP_006510118.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652
Ig3_NCAM-1_like 211..308 CDD:143207 25/99 (25%)
Ig_NCAM-1 307..413 CDD:143277 34/112 (30%)
Ig_3 417..494 CDD:372822 23/82 (28%)
FN3 509..606 CDD:238020 25/107 (23%)
fn3 649..731 CDD:365830
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11169
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.