DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Ncam1

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:423 Identity:113/423 - (26%)
Similarity:181/423 - (42%) Gaps:69/423 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AEHSVVRYT---NESLIVQCRS---PDPKVELHWKSPKGEII--REHKGRIHIEQTSTEQLKIVF 86
            |..|:|..|   .:|:.:.|.:   |:|  .:.| :..||.|  .|.....||....:.:|.|  
Mouse   216 ARQSIVNATANLGQSVTLVCDADGFPEP--TMSW-TKDGEPIENEEEDDEKHIFSDDSSELTI-- 275

  Fly    87 AHIALADKGNWSCEA------ADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGE 145
            .::...|:..:.|.|      .|.|:|.|.|   ...|||:.||.|.|.::  |:.|:.||..|:
Mouse   276 RNVDKNDEAEYVCIAENKAGEQDASIHLKVF---AKPKITYVENQTAMELE--EQVTLTCEASGD 335

  Fly   146 PQPNVTWHFNGQPIS----AGAADDSKFRILADG------------LLINKVTQNDTGEYACRAY 194
            |.|::||..:.:.||    |......|...| ||            |.:..:...|.|||.|.| 
Mouse   336 PIPSITWRTSTRNISSEEKASWTRPEKQETL-DGHMVVRSHARVSSLTLKSIQYTDAGEYICTA- 398

  Fly   195 QVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKL- 258
             .|:|..|.|  ::.:::::.|   |.......|.:......:.||..|.|.|..:|:|....| 
Mouse   399 -SNTIGQDSQ--SMYLEVQYAP---KLQGPVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLP 457

  Fly   259 ---HSNNRLYTIQSDSYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQL 320
               :||.::|...|.||   |.:...:.:.|.||.|.|.|.:|.......|.|.:.|.||:..::
Mouse   458 SSNYSNIKIYNTPSASY---LEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDRV 519

  Fly   321 RGFNSNTFDVVLSAPRGPPDSPMGVNGFRIEYMTEMEFKTDAG---KWTNARRKDYAFEEGATFL 382
            ..: |:|..|....|......|:      ::|..|.:...:..   ||.:|:.   |..||...:
Mouse   520 EPY-SSTAQVQFDEPEATGGVPI------LKYKAEWKSLGEESWHFKWYDAKE---ANMEGIVTI 574

  Fly   383 LTNLEPDTVYLVRAASRNLAGFSDFTKVEKYKT 415
            : .|:|:|.|.||.|:.|..|..:.:...::||
Mouse   575 M-GLKPETRYSVRLAALNGKGLGEISAATEFKT 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 24/95 (25%)
IgI_Twitchin_like 120..208 CDD:409541 32/103 (31%)
Ig strand A 120..123 CDD:409541 1/2 (50%)
Ig strand A' 127..131 CDD:409541 1/3 (33%)
Ig strand B 134..141 CDD:409541 2/6 (33%)
Ig strand C 149..154 CDD:409541 2/4 (50%)
Ig strand C' 156..159 CDD:409541 0/2 (0%)
Ig strand D 165..170 CDD:409541 1/4 (25%)
Ig strand E 173..178 CDD:409541 3/16 (19%)
Ig strand F 187..195 CDD:409541 5/7 (71%)
Ig strand G 198..208 CDD:409541 3/9 (33%)
IG_like 228..307 CDD:214653 23/82 (28%)
Ig strand B 235..239 CDD:409353 0/3 (0%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
FN3 312..415 CDD:238020 25/105 (24%)
Ncam1XP_006510118.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand A 20..25 CDD:409451
Ig strand A' 28..32 CDD:409451
Ig strand B 34..44 CDD:409451
Ig strand C 50..56 CDD:409451
Ig strand C' 59..61 CDD:409451
Ig strand D 69..75 CDD:409451
Ig strand E 77..85 CDD:409451
Ig strand F 92..100 CDD:409451
Ig strand G 104..115 CDD:409451
IG_like 124..190 CDD:214653
Ig strand B 135..139 CDD:409353
Ig strand C 148..152 CDD:409353
Ig strand E 172..176 CDD:409353
Ig strand F 186..191 CDD:409353
IgI_3_NCAM-1 211..308 CDD:143207 25/99 (25%)
Ig strand A 211..216 CDD:143207 113/423 (27%)
Ig strand A' 220..226 CDD:143207 2/5 (40%)
Ig strand B 229..239 CDD:143207 2/9 (22%)
Ig strand C 243..249 CDD:143207 2/8 (25%)
Ig strand C' 251..253 CDD:143207 1/1 (100%)
Ig strand D 263..266 CDD:143207 1/2 (50%)
Ig strand E 271..277 CDD:143207 2/7 (29%)
Ig strand F 283..292 CDD:143207 2/8 (25%)
Ig strand G 295..307 CDD:143207 5/14 (36%)
IgI_NCAM-1 307..413 CDD:143277 34/112 (30%)
Ig strand A 307..312 CDD:143277 1/4 (25%)
Ig strand A' 316..320 CDD:143277 2/3 (67%)
Ig strand B 325..333 CDD:143277 3/7 (43%)
Ig strand C 339..345 CDD:143277 2/5 (40%)
Ig strand C' 348..351 CDD:143277 1/2 (50%)
Ig strand D 369..375 CDD:143277 0/5 (0%)
Ig strand E 378..384 CDD:143277 1/5 (20%)
Ig strand F 392..400 CDD:143277 5/9 (56%)
Ig strand G 403..413 CDD:143277 2/11 (18%)
IG_like 422..500 CDD:214653 23/80 (29%)
Ig strand B 433..437 CDD:409353 0/3 (0%)
Ig strand C 446..450 CDD:409353 0/3 (0%)
Ig strand E 473..477 CDD:409353 3/6 (50%)
Ig strand F 487..492 CDD:409353 3/4 (75%)
fn3 512..599 CDD:394996 24/97 (25%)
fn3 649..731 CDD:394996
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.