DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and lad-2

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001023496.1 Gene:lad-2 / 177078 WormBaseID:WBGene00002243 Length:1187 Species:Caenorhabditis elegans


Alignment Length:371 Identity:87/371 - (23%)
Similarity:139/371 - (37%) Gaps:75/371 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ESLSLSPAEHSVVRYTNESLIVQC---RSPDPKVELHWKSPKGEIIREHKGRIHIEQTSTEQ--- 81
            :.:|:||:|.:|  .....|.:||   ..|.|.:  .|....||:   .|.||. :.||.|.   
 Worm   238 KKMSVSPSEVTV--RAGGQLKLQCIFGGRPLPTI--FWSKIDGEL---PKSRIK-DLTSHESDFG 294

  Fly    82 LKIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQKITFTENATVM-------------TVKEG 133
            ..::..::...|.|.:.|..               :.:..|.|..||             ::.|.
 Worm   295 RSLIVENVHPDDAGAYECRG---------------RHLVHTVNVRVMAAPFWEFDPPRDISLPEE 344

  Fly   134 EKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILADGLLINKVTQN---DTGEYACRAYQ 195
            ....:.|...|:|.|.:||..||:.:.. .|:||:..:|..|.::.....|   |||.|.|.|  
 Worm   345 STGELECLAGGQPTPIITWSMNGKFLHE-LAEDSRRVLLDHGRILRVRNLNHDLDTGVYQCNA-- 406

  Fly   196 VNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWY----RKHN 256
            .|.:........|.:: .|.|.: :.|........::.|..|.|:..|.|.|...|.    |...
 Worm   407 SNPLGYVFANAFVHVR-AHAPFF-RMPAARHWKVVLHSTVVLDCDVDAAPEAMVRWVDADDRPLQ 469

  Fly   257 KLHSNNRLYTIQSDSYWSSLTIHVLNTSAFDN--YRCRARNDLGTIERTTRLEQGEKP------P 313
            .:...|:|:        .:.|..|.:.::.|.  |.|...|..| |.|.|...|..||      |
 Worm   470 VVEGKNKLF--------PNHTFMVYDVNSADEGLYYCNVSNKYG-INRATNRLQVFKPTYFVRIP 525

  Fly   314 SPANFQLR-GFNSNTFDVVLSAPRGPPDSPMGVNGFRIEYMTEMEF 358
            :|....|. |..:..|...::.||.|......:||   :.:||.::
 Worm   526 TPKRLILEAGETAEVFCEAVADPRLPIRYQWTING---KVLTESQY 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 18/87 (21%)
IgI_Twitchin_like 120..208 CDD:409541 26/103 (25%)
Ig strand A 120..123 CDD:409541 0/2 (0%)
Ig strand A' 127..131 CDD:409541 2/16 (13%)
Ig strand B 134..141 CDD:409541 0/6 (0%)
Ig strand C 149..154 CDD:409541 2/4 (50%)
Ig strand C' 156..159 CDD:409541 1/2 (50%)
Ig strand D 165..170 CDD:409541 2/4 (50%)
Ig strand E 173..178 CDD:409541 1/4 (25%)
Ig strand F 187..195 CDD:409541 4/7 (57%)
Ig strand G 198..208 CDD:409541 0/9 (0%)
IG_like 228..307 CDD:214653 20/84 (24%)
Ig strand B 235..239 CDD:409353 1/3 (33%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 0/3 (0%)
Ig strand F 288..293 CDD:409353 2/6 (33%)
FN3 312..415 CDD:238020 13/54 (24%)
lad-2NP_001023496.1 Ig 25..121 CDD:472250
Ig strand B 49..53 CDD:409353
Ig strand C 61..65 CDD:409353
Ig strand E 87..91 CDD:409353
Ig strand F 101..106 CDD:409353
Ig strand G 115..118 CDD:409353
Ig 133..216 CDD:472250
Ig strand B 144..148 CDD:409353
Ig strand C 158..162 CDD:409353
Ig strand E 186..190 CDD:409353
Ig strand F 203..208 CDD:409353
Ig 243..325 CDD:472250 23/104 (22%)
Ig strand B 255..259 CDD:409353 1/3 (33%)
Ig strand C 268..272 CDD:409353 0/5 (0%)
Ig strand E 295..299 CDD:409353 0/3 (0%)
Ig strand F 309..314 CDD:409353 1/4 (25%)
Ig4_L1-NrCAM_like 330..422 CDD:409367 23/94 (24%)
Ig strand B 347..351 CDD:409367 0/3 (0%)
Ig strand C 360..364 CDD:409367 1/3 (33%)
Ig strand E 386..390 CDD:409367 0/3 (0%)
Ig strand F 401..406 CDD:409367 2/4 (50%)
Ig strand G 414..417 CDD:409367 0/2 (0%)
IG_like 438..515 CDD:214653 20/85 (24%)
Ig strand B 444..448 CDD:409353 1/3 (33%)
Ig strand C 457..461 CDD:409353 0/3 (0%)
Ig strand E 482..485 CDD:409353 1/2 (50%)
Ig strand F 495..500 CDD:409353 2/4 (50%)
Ig strand G 508..511 CDD:409353 1/2 (50%)
Ig 527..593 CDD:472250 11/45 (24%)
Ig strand B 538..542 CDD:409353 0/3 (0%)
Ig strand C 551..557 CDD:409353 1/5 (20%)
Ig strand E 574..578 CDD:409353
Ig strand F 588..593 CDD:409353
FN3 610..697 CDD:238020
FN3 <666..1095 CDD:442628
fn3 823..909 CDD:394996
FN3 921..1010 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.