DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and zig-8

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:238 Identity:45/238 - (18%)
Similarity:84/238 - (35%) Gaps:65/238 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILNLAALTAVAWANHHESLSLSPAEHSVVRYTNESLI---------VQCR-SPDPKVELHW---- 57
            ::..:.|.|.......|.::....|.|.|...:::::         :.|. .||.:.|:.|    
 Worm     9 VILFSFLYATGHGASEEVMACLRQERSRVENPSQTIVNVVAENPAYLHCSVPPDAEHEIAWTRVS 73

  Fly    58 -------------KSPKGEIIREHKGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSK 109
                         :.|:.::.::......:.....||          .|.|.:.||..|  .|:.
 Worm    74 DGALLTAGNRTFTRDPRWQVSKKSANIWVLNLRRAEQ----------QDSGCYLCEIND--KHNT 126

  Fly   110 SFDLIVYQKI---------TFTENAT-VMTVKEGEKATILCEV----KGEPQPNVTWHFNGQPIS 160
            .:  .||.|:         :..:.:| :|....|::..:.|.|    |.|...:|.|..:|..|:
 Worm   127 VY--AVYLKVLEPPLPSPSSLQKKSTKLMANMSGDEVVLNCTVTSTDKDEEVLDVVWTRDGNTIN 189

  Fly   161 AGAADDSKF--------RILADGLLINKVTQNDTGEYACRAYQ 195
            ..  |..|:        .::.:.:.|.|.|..|.|.|||...|
 Worm   190 FN--DTEKYILKVKRDAGVVIETMRIRKATMEDDGNYACEHSQ 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 16/108 (15%)
I-set 128..202 CDD:254352 21/80 (26%)
Ig 133..>193 CDD:299845 19/71 (27%)
IG_like 228..307 CDD:214653
Ig 235..305 CDD:143165
FN3 312..415 CDD:238020
zig-8NP_499714.1 IG_like 55..134 CDD:214653 16/92 (17%)
Ig 55..129 CDD:143165 14/87 (16%)
ig 158..229 CDD:278476 19/72 (26%)
IG_like 158..227 CDD:214653 18/70 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.