DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and rig-5

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:289 Identity:75/289 - (25%)
Similarity:116/289 - (40%) Gaps:54/289 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GRIHIEQTSTEQLKIVFAHIALADKGNWSCE--AADGSLHSKSFDLIVYQKITFTENATVMTVKE 132
            |.:|.|...|      ..::..:|:||:||:  ....:|.:...|:.|...::.:..|.| .|:|
 Worm   148 GDLHNEWVLT------IKNVQESDRGNYSCQINTEPITLSTGELDVKV
PPVVSRSTPAAV-EVRE 205

  Fly   133 GEKATILCEVKGEPQPNVTW--------HFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEY 189
            |...::.|:..|.|.|.|.|        .:||    |.....|.|.  ...|.:.||::....||
 Worm   206 GNNVSLTCKADGNPTPTVIWRRQDRQIIRYNG----ATGFGASVFH--GPVLHLTKVSRKHMSEY 264

  Fly   190 ACRAYQVNSIASDMQERTVLMKIEHKPI---WSKTPFVSLKYAYINGTATLMCEALAEPPANFTW 251
            .|.|  .|.|..| :..||.:.:...|:   .|:|     ..|.:...|.::|...|.|.....|
 Worm   265 LCVA--SN
GIPPD-ESWTVKLLVTFPPLVQAQSET-----VQASVGSMARMVCTTEAWPRPEMGW 321

  Fly   252 YRKHNKLHSNNRL---YTIQSDSYWSSLTIHVL-----NTSAFDNYRCRARNDLGTIERTTRLEQ 308
            .:....::.:|.:   :|: |..|.|   :|:|     .:|.|..|||.|:||.|.......|.|
 Worm   322 EKDGEPVYESNNVAMTHTV-SGQYHS---VHILEIRNVQSSHFGVYRCVAKNDNGIHHSQVTLNQ 382

  Fly   309 GEKPPSPANFQLRGFNSNTFDVVLSAPRG 337
                .|..:|.    |||........|||
 Worm   383 ----ISHNHFT----NSNLIPEGSGMPRG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 11/46 (24%)
I-set 128..202 CDD:254352 23/81 (28%)
Ig 133..>193 CDD:299845 18/67 (27%)
IG_like 228..307 CDD:214653 22/86 (26%)
Ig 235..305 CDD:143165 21/77 (27%)
FN3 312..415 CDD:238020 8/26 (31%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 11/46 (24%)
Ig_3 191..270 CDD:372822 23/87 (26%)
IG 294..380 CDD:214652 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.