DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and rig-5

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:289 Identity:75/289 - (25%)
Similarity:116/289 - (40%) Gaps:54/289 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GRIHIEQTSTEQLKIVFAHIALADKGNWSCE--AADGSLHSKSFDLIVYQKITFTENATVMTVKE 132
            |.:|.|...|      ..::..:|:||:||:  ....:|.:...|:.|...::.:..|.| .|:|
 Worm   148 GDLHNEWVLT------IKNVQESDRGNYSCQINTEPITLSTGELDVKVPPVVSRSTPAAV-EVRE 205

  Fly   133 GEKATILCEVKGEPQPNVTW--------HFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEY 189
            |...::.|:..|.|.|.|.|        .:||    |.....|.|.  ...|.:.||::....||
 Worm   206 GNNVSLTCKADGNPTPTVIWRRQDRQIIRYNG----ATGFGASVFH--GPVLHLTKVSRKHMSEY 264

  Fly   190 ACRAYQVNSIASDMQERTVLMKIEHKPI---WSKTPFVSLKYAYINGTATLMCEALAEPPANFTW 251
            .|.|  .|.|..| :..||.:.:...|:   .|:|     ..|.:...|.::|...|.|.....|
 Worm   265 LCVA--SNGIPPD-ESWTVKLLVTFPPLVQAQSET-----VQASVGSMARMVCTTEAWPRPEMGW 321

  Fly   252 YRKHNKLHSNNRL---YTIQSDSYWSSLTIHVL-----NTSAFDNYRCRARNDLGTIERTTRLEQ 308
            .:....::.:|.:   :|: |..|.|   :|:|     .:|.|..|||.|:||.|.......|.|
 Worm   322 EKDGEPVYESNNVAMTHTV-SGQYHS---VHILEIRNVQSSHFGVYRCVAKNDNGIHHSQVTLNQ 382

  Fly   309 GEKPPSPANFQLRGFNSNTFDVVLSAPRG 337
                .|..:|.    |||........|||
 Worm   383 ----ISHNHFT----NSNLIPEGSGMPRG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 11/46 (24%)
IgI_Twitchin_like 120..208 CDD:409541 26/95 (27%)
Ig strand A 120..123 CDD:409541 0/2 (0%)
Ig strand A' 127..131 CDD:409541 1/3 (33%)
Ig strand B 134..141 CDD:409541 0/6 (0%)
Ig strand C 149..154 CDD:409541 2/12 (17%)
Ig strand C' 156..159 CDD:409541 1/2 (50%)
Ig strand D 165..170 CDD:409541 1/4 (25%)
Ig strand E 173..178 CDD:409541 1/4 (25%)
Ig strand F 187..195 CDD:409541 4/7 (57%)
Ig strand G 198..208 CDD:409541 2/9 (22%)
IG_like 228..307 CDD:214653 22/86 (26%)
Ig strand B 235..239 CDD:409353 1/3 (33%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 1/3 (33%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
FN3 312..415 CDD:238020 8/26 (31%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 11/46 (24%)
Ig strand B 102..106 CDD:409353
Ig strand C 118..122 CDD:409353
Ig strand E 154..158 CDD:409353 1/9 (11%)
Ig strand F 168..173 CDD:409353 3/4 (75%)
Ig_3 190..270 CDD:464046 23/88 (26%)
Ig_3 287..369 CDD:464046 22/90 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.