DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Dscam

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_038943864.1 Gene:Dscam / 171119 RGDID:619992 Length:2034 Species:Rattus norvegicus


Alignment Length:468 Identity:110/468 - (23%)
Similarity:195/468 - (41%) Gaps:109/468 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LSLSPAEHSVVRY-------------TNESLIVQC--RSPDPKVELHWKSPKGEIIREHKGRIHI 74
            ||.|.:.|..|:.             ..:.:.:.|  .|.|..:.:.|:. .|..|....| :.|
  Rat   583 LSTSQSVHVTVKVPPFIQPFEFPRFSIGQRVFIPCVVVSGDLPITITWQK-DGRPIPASLG-VTI 645

  Fly    75 EQTS-TEQLKIVFAHIALADKGNWSC----EAADGSLHSKSFDLIVYQKITFTENATVMTVKEGE 134
            :... |..|:|  ::::|...||::|    |||.....|:   |||.....|     |:..::.:
  Rat   646 DNIDFTSSLRI--SNLSLMHNGNYTCIARNEAAAVEHQSQ---LIVRVPPKF-----VVQPRDQD 700

  Fly   135 ----KATIL-CEVKGEPQPNVTWHFN---GQPISAGAADDSKFRILADG-LLINKVTQNDTGEYA 190
                ||.|| |..:|.|.|.:.|.|:   |.|.....|.:.:.::|::| |||..|.:.|:|.|.
  Rat   701 GIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYL 765

  Fly   191 CRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKY-----AYINGT-AT------LMCEALA 243
            |:.  .|.:.:|:               ||:.::::|.     :|.|.| ||      :.|.|..
  Rat   766 CKV--SNDVGADV---------------SKSMYLTVKIPAMITSYPNTTLATQGQRKEMSCTAHG 813

  Fly   244 EPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSL--TIHVLNTSAFDN--YRCRARN----DLGTI 300
            |.|....|.::...::.....|.:.:......:  |:.:|.|...|:  :.|.|.|    |.|.|
  Rat   814 EKPIIVRWEKEDRIINPEMARYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGEDRGII 878

  Fly   301 ERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRG-PPDSPMGVNGFRIEYMTEMEFKTDAGK 364
            :.|.     ::||.|...:::...:.|  :.|....| ..:||  :.|:      ::|.|..:..
  Rat   879 QLTV-----QEPPDPPEIEIKDVKART--ITLRWTMGFDGNSP--ITGY------DIECKNKSDS 928

  Fly   365 WTNARR-KDYAFE-EGATFLLTNLEPDTVYLVRAASRNLAGFSD------FTKVEKY-----KTL 416
            |.:|:| ||.:.: ..||.:  ::.|.:.|.:|..::|..|.|:      .|..|..     :.:
  Rat   929 WDSAQRTKDVSPQLNSATII--DIHPSSTYSIRMYAKNRIGKSEPSNEITITADEAAPDGPPQEV 991

  Fly   417 SLEPRVSSGVKET 429
            .|||..|..::.|
  Rat   992 HLEPTSSQSIRVT 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 21/101 (21%)
I-set 128..202 CDD:254352 24/82 (29%)
Ig 133..>193 CDD:299845 23/68 (34%)
IG_like 228..307 CDD:214653 22/98 (22%)
Ig 235..305 CDD:143165 19/83 (23%)
FN3 312..415 CDD:238020 26/116 (22%)
DscamXP_038943864.1 Ig 26..121 CDD:416386
Ig strand A' 33..37 CDD:409353
Ig strand B 40..49 CDD:409353
Ig strand C 55..61 CDD:409353
Ig strand C' 63..66 CDD:409353
Ig strand D 72..75 CDD:409353
Ig strand E 80..85 CDD:409353
Ig strand F 98..106 CDD:409353
Ig strand G 109..121 CDD:409353
Ig 125..210 CDD:416386
Ig strand A 126..130 CDD:409353
Ig strand A' 132..136 CDD:409353
Ig strand B 139..149 CDD:409353
Ig strand C 157..163 CDD:409353
Ig strand C' 164..167 CDD:409353
Ig strand E 179..185 CDD:409353
Ig strand F 191..201 CDD:409353
IGc2 239..300 CDD:197706
Ig strand B 242..246 CDD:409353
Ig strand C 255..259 CDD:409353
Ig strand F 290..295 CDD:409353
Ig 313..395 CDD:416386
Ig strand A 314..319 CDD:409353
Ig strand A' 322..326 CDD:409353
Ig strand B 329..339 CDD:409353
Ig strand C 344..350 CDD:409353
Ig strand C' 351..354 CDD:409353
Ig strand E 368..374 CDD:409353
Ig strand F 381..389 CDD:409353
Ig 406..501 CDD:416386
Ig strand A 406..409 CDD:409353
Ig strand A' 415..419 CDD:409353
Ig strand B 422..431 CDD:409353
Ig strand C 436..442 CDD:409353
Ig strand C' 444..447 CDD:409353
Ig strand D 452..460 CDD:409353
Ig strand E 464..473 CDD:409353
Ig strand F 480..488 CDD:409353
Ig strand G 491..501 CDD:409353
Ig 504..593 CDD:416386 4/9 (44%)
Ig strand A 505..507 CDD:409353
Ig strand A' 512..516 CDD:409353
Ig strand B 519..526 CDD:409353
Ig strand C 533..539 CDD:409353
Ig strand C' 540..542 CDD:409353
Ig strand D 549..553 CDD:409353
Ig strand E 557..563 CDD:409353
Ig strand F 571..579 CDD:409353
Ig strand G 583..593 CDD:409353 4/9 (44%)
Ig 596..686 CDD:416386 20/96 (21%)
Ig strand A 597..599 CDD:409353 0/1 (0%)
Ig strand B 611..620 CDD:409353 1/8 (13%)
Ig strand C 625..632 CDD:409353 1/6 (17%)
Ig strand C' 634..636 CDD:409353 1/1 (100%)
Ig strand D 643..648 CDD:409353 1/4 (25%)
Ig strand E 651..658 CDD:409353 3/8 (38%)
Ig strand F 665..673 CDD:409353 3/7 (43%)
Ig strand G 676..685 CDD:409353 2/11 (18%)
Ig_DSCAM 689..784 CDD:409397 29/116 (25%)
Ig strand B 707..711 CDD:409397 2/3 (67%)
Ig strand C 720..724 CDD:409397 0/3 (0%)
Ig strand E 749..753 CDD:409397 2/3 (67%)
Ig strand F 763..768 CDD:409397 2/4 (50%)
Ig strand G 777..780 CDD:409397 2/2 (100%)
Ig_DSCAM 785..884 CDD:409398 23/103 (22%)
Ig strand B 805..809 CDD:409398 0/3 (0%)
Ig strand C 818..822 CDD:409398 0/3 (0%)
Ig strand E 848..852 CDD:409398 1/3 (33%)
Ig strand F 862..867 CDD:409398 1/4 (25%)
Ig strand G 875..878 CDD:409398 1/2 (50%)
FN3 885..978 CDD:238020 24/104 (23%)
FN3 986..1083 CDD:238020 5/19 (26%)
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig_3 1287..1363 CDD:404760
Ig strand B 1303..1307 CDD:409353
Ig strand C 1316..1320 CDD:409353
Ig strand E 1342..1346 CDD:409353
Ig strand F 1356..1361 CDD:409353
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.