DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Opcml

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:336 Identity:84/336 - (25%)
Similarity:130/336 - (38%) Gaps:69/336 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LTAVAWANHHESLSLSPAEHSVVRYT-NESLIVQCRSPDPKVELHWKSPKGEIIREHKGRIHIEQ 76
            :|.|||.|           .|.:.|. |:..     |.||:|                  |.:..
  Rat    63 VTRVAWLN-----------RSTILYAGNDKW-----SIDPRV------------------IILVN 93

  Fly    77 TSTEQLKIVFAHIALADKGNWSCEA-ADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILC 140
            |.| |..|:..::.:.|:|.::|.. .|....:....|||.........::.:||.||...|:||
  Rat    94 TPT-QYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLC 157

  Fly   141 EVKGEPQPNVTWHFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRAYQVNSIASDMQE 205
            ...|.|:|.|||.........|...:.::      |.|:.:.::.:|||.|.|  :|.:|:. ..
  Rat   158 LAIGRPEPTVTWRHLSVKEGQGFVSEDEY------LEISDIKRDQSGEYECSA--LNDVAAP-DV 213

  Fly   206 RTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQSD 270
            |.|.:.:.:.|..||.....:.   :.....|.|||.|.|.|.|.|:::..:|.:......|::.
  Rat   214 RKVKITVNYPPYISKAKNTGVS---VGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENK 275

  Fly   271 SYWSSLTIHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAP 335
            ...|:||...::...:.||.|.|.|.||....:..|.  |..||                  ||.
  Rat   276 GRISTLTFFNVSEKDYGNYTCVATNKLGNTNASITLY--EISPS------------------SAV 320

  Fly   336 RGPPDSPMGVN 346
            .||.....|||
  Rat   321 AGPGAVIDGVN 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 17/83 (20%)
I-set 128..202 CDD:254352 23/73 (32%)
Ig 133..>193 CDD:299845 17/59 (29%)
IG_like 228..307 CDD:214653 21/78 (27%)
Ig 235..305 CDD:143165 21/69 (30%)
FN3 312..415 CDD:238020 9/35 (26%)
OpcmlXP_017450901.1 Ig 44..132 CDD:416386 22/103 (21%)
Ig strand A' 44..49 CDD:409353
Ig strand B 51..59 CDD:409353
CDR1 59..63 CDD:409353 84/336 (25%)
FR2 64..70 CDD:409353 4/5 (80%)
Ig strand C 64..70 CDD:409353 4/5 (80%)
CDR2 71..83 CDD:409353 3/16 (19%)
Ig strand C' 72..76 CDD:409353 1/3 (33%)
Ig strand C' 80..83 CDD:409353 0/7 (0%)
FR3 84..118 CDD:409353 11/52 (21%)
Ig strand D 87..94 CDD:409353 2/24 (8%)
Ig strand E 97..103 CDD:409353 2/5 (40%)
Ig strand F 110..118 CDD:409353 2/7 (29%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 1/8 (13%)
FR4 125..132 CDD:409353 1/6 (17%)
Ig_3 135..206 CDD:404760 21/78 (27%)
Ig strand A 135..138 CDD:409353 0/2 (0%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 3/8 (38%)
Ig strand C 165..170 CDD:409353 3/4 (75%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 5/9 (56%)
Ig_3 223..300 CDD:404760 21/79 (27%)
putative Ig strand A 224..230 CDD:409353 3/5 (60%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 1/3 (33%)
Ig strand E 279..283 CDD:409353 2/3 (67%)
Ig strand F 293..298 CDD:409353 3/4 (75%)
Ig strand G 306..309 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337188
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.