DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and Dscaml1

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001074739.2 Gene:Dscaml1 / 114873 MGIID:2150309 Length:2053 Species:Mus musculus


Alignment Length:466 Identity:106/466 - (22%)
Similarity:179/466 - (38%) Gaps:103/466 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LSLSPAEHSVVRY-------------TNESLIVQC--RSPDPKVELHWKSPKGEIIREHKGRIHI 74
            ||:|.:.|..|:.             ..:.|.:.|  .|.|..:.:.|:. .|::|....| :.|
Mouse   583 LSISQSVHVAVKVPPLIQPFEFPPASIGQLLYIPCVVSSGDMPIRITWRK-DGQVIISGSG-VTI 645

  Fly    75 EQTSTEQL-KIVFAHIALADKGNWSCEAADGSLH-SKSFDLIVYQKITFTENATVMTVKEGEKAT 137
            |  |.|.: .:..:.::|...||::|.|::.:.. |:...|||.....|...........|:...
Mouse   646 E--SKEFMSSLQISSVSLKHNGNYTCIASNAAATVSRERQLIVRVPPRFVVQPNNQDGIYGKAGV 708

  Fly   138 ILCEVKGEPQPNVTW-HFNGQ---------PISAGAADDSKFRILAD-GLLINKVTQNDTGEYAC 191
            :.|.|.|.|.|.|.| |..|.         |::      .:.:||.: .|||..|.:.|.|.|.|
Mouse   709 LNCSVDGYPPPKVMWKHAKGSGNPQQYHPVPLT------GRIQILPNSSLLIRHVLEEDIGYYLC 767

  Fly   192 RAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKY-----AYINGTAT-------LMCEALAE 244
            :|  .|.:.:|:               ||..|:::|.     ::.|.|..       |.|.|..|
Mouse   768 QA--SNGVGTDI---------------SKAMFLTVKIPAMITSHPNTTIAIKGHPKELNCTARGE 815

  Fly   245 PPANFTWYRKHNKLHSNNRL--YTI----QSDSYWSSLTIHVLNTSAFDNYRCRARN----DLGT 299
            .|....| .|.:.:...:|:  |.|    ..|...|:|.:...:......:.|.|.|    |.|.
Mouse   816 RPIIIRW-EKGDTVIDPDRVMRYAIATKDNGDEVVSTLKLKPADRGDSVFFSCHAINSYGEDRGL 879

  Fly   300 IERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRGPPDSPMGVNGFRIEYMTEMEFKTDAGK 364
            |:.|.     ::||.|...::|...:.:.::..:...   |....:.||.|||..    |:|:..
Mouse   880 IQLTV-----QEPPDPPELEIREVKARSMNLRWTQRF---DGNSIITGFDIEYKN----KSDSWD 932

  Fly   365 WTNARRKDYAFEEGATFLLTNLEPDTVYLVRAASRNLAGFSDFTKVEKYKT-----------LSL 418
            :..:.|........|.  :.:|.|.:||.:|..|.|..|.|:.:|.....|           ::|
Mouse   933 FKQSTRNISPTINQAN--IVDLHPASVYSIRMYSFNKIGRSEPSKELTISTEEAAPDGPPMDVTL 995

  Fly   419 EPRVSSGVKET 429
            :|..|..::.|
Mouse   996 QPVTSQSIQVT 1006

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 20/98 (20%)
I-set 128..202 CDD:254352 23/84 (27%)
Ig 133..>193 CDD:299845 21/70 (30%)
IG_like 228..307 CDD:214653 22/100 (22%)
Ig 235..305 CDD:143165 20/86 (23%)
FN3 312..415 CDD:238020 24/102 (24%)
Dscaml1NP_001074739.2 IGc2 43..110 CDD:197706
Ig 125..218 CDD:353325
I-set 226..311 CDD:336764
Ig_3 317..389 CDD:339005
Ig 408..498 CDD:353325
IGc2 519..577 CDD:197706
Ig 615..681 CDD:319273 17/69 (25%)
Ig_DSCAM 707..785 CDD:143211 26/100 (26%)
Ig 803..891 CDD:353325 22/93 (24%)
FN3 887..981 CDD:238020 24/102 (24%)
FN3 988..1085 CDD:238020 4/19 (21%)
FN3 1093..1186 CDD:238020
FN3 1191..1282 CDD:238020
Ig 1307..1377 CDD:319273
FN3 1384..1474 CDD:238020
FN3 1488..1560 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1716..1741
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1773..1803
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1840..1862
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1974..2053
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.