DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and CHL1

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_006605.2 Gene:CHL1 / 10752 HGNCID:1939 Length:1224 Species:Homo sapiens


Alignment Length:451 Identity:111/451 - (24%)
Similarity:174/451 - (38%) Gaps:112/451 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SPAEHSVVRYTNESLIVQCRS---PDPKVELHWKS-----PKGEIIREHKGRIHIEQTSTEQLKI 84
            |.:|.|:.....|.|:::|.:   |.|:|:  |..     |||...:|:.|:         .|||
Human   260 SGSESSITILKGEILLLECFAEGLPTPQVD--WNKIGGDLPKGRETKENYGK---------TLKI 313

  Fly    85 VFAHIALADKGNWSCEAAD--GSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQ 147
              .:::..||||:.|.|::  |:. :..|.:||.:...:|:.........|....:|||.:||||
Human   314 --ENVSYQDKGNYRCTASNFLGTA-THDFHVIVEEPPRWTKKPQSAVYSTGSNGILLCEAEGEPQ 375

  Fly   148 PNVTWHFNGQPISAGAADDSKFR---ILADGLLINKVTQNDTGEYACRAYQVNSIASDMQERTVL 209
            |.:.|..||.|:     |:..|.   :....:....:..|.|..|.|.|..|:.        |:|
Human   376 PTIKWRVNGSPV-----DNHPFAGDVVFPREISFTNLQPNHTAVYQCEASNVHG--------TIL 427

  Fly   210 MKIEHKPIWSKTPFVSLK----YAYING-TATLMCEALAEPPANFTWYRKHNKLHSNNRLYTIQS 269
            .. .:..:....|.:..|    ||.:.| :|.|.||..|.|.|..:|.:.........|.|.|..
Human   428 AN-ANIDVVDVRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVEEVKPLEGRRYHIYE 491

  Fly   270 DSYWSSLTIHVLNTSAFD--NYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVVL 332
            :.     |:.:..|:..|  :|.|...|.:|            |....||..:|  |:....|..
Human   492 NG-----TLQINRTTEEDAGSYSCWVENAIG------------KTAVTANLDIR--NATKLRVSP 537

  Fly   333 SAPRGPPDSPMGVNGFRIEYMTEM--EFKTDAG-------KWTNARRKD-YAFE----------- 376
            ..||.|.           .:|.|:  |.|.|:.       .|:    || .|||           
Human   538 KNPRIPK-----------LHMLELHCESKCDSHLKHSLKLSWS----KDGEAFEINGTEDGRIII 587

  Fly   377 EGATFLLTN--LEPDTVYLVRAASRNLAGFSDFTKV------EKYKTLSLEPRVSSGVKET 429
            :||...::|  ||...:|.. :|...|...:|.|:|      :..:.|.|..|.:..|:.|
Human   588 DGANLTISNVTLEDQGIYCC-SAHTALDSAADITQVTVLDVPDPPENLHLSERQNRSVRLT 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 24/91 (26%)
I-set 128..202 CDD:254352 21/76 (28%)
Ig 133..>193 CDD:299845 19/62 (31%)
IG_like 228..307 CDD:214653 21/81 (26%)
Ig 235..305 CDD:143165 18/71 (25%)
FN3 312..415 CDD:238020 30/131 (23%)
CHL1NP_006605.2 Ig 55..126 CDD:299845
Ig2_L1-CAM_like 129..223 CDD:143253
IG_like 140..224 CDD:214653
IG_like 264..343 CDD:214653 24/92 (26%)
Ig3_L1-CAM_like 274..344 CDD:143208 23/83 (28%)
IG_like 353..434 CDD:214653 23/94 (24%)
Ig4_L1-NrCAM_like 361..435 CDD:143179 23/87 (26%)
IG_like 447..525 CDD:214653 23/94 (24%)
Ig 457..525 CDD:299845 20/84 (24%)
IG_like 548..624 CDD:214653 21/80 (26%)
Ig 548..616 CDD:143165 18/72 (25%)
DGEA 571..574 1/2 (50%)
FN3 628..717 CDD:238020 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 709..732
fn3 731..811 CDD:278470
FN3 834..927 CDD:238020
FN3 932..1027 CDD:238020
Bravo_FIGEY 1120..1205 CDD:290593
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1147..1179
FIG[AQ]Y 1197..1201
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1205..1224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.