DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and iglon5

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:300 Identity:75/300 - (25%)
Similarity:133/300 - (44%) Gaps:35/300 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PAEHSVVRYTNESLIVQCRSPDPKVELHWKSPKGEIIREHK------GRIHIEQTSTEQLKIVFA 87
            ||::..|. ..::..:.|...|....:.|.: :..|:...|      .|:.:...:..:..||..
 Frog    32 PADNYTVS-QGDNATLSCLIDDKVTRVAWLN-RSNILYAGKDKWSIDSRVQLLTNTKSEYSIVIT 94

  Fly    88 HIALADKGNWSCE-AADGSLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNVT 151
            |:.:||:|.::|. ..:...|:....|||.........::.:||.||....:.|...|:|:|.:|
 Frog    95 HVDVADEGLYTCSFQTEDKPHTSQVYLIVQVPAKIVNISSSVTVNEGSNVNLQCLAVGKPEPTIT 159

  Fly   152 WHFNGQPISAGAADDSKFRILADGLLINKVTQNDTGEYACRAYQVNSIASDMQE-RTVLMKIEHK 215
            |    |.:|.|.:.:.:.      |.|.::.:...|:|.|    |.|....:.: :.|.:.:.:.
 Frog   160 W----QQLSEGFSSEGEL------LEITEINRQQAGDYEC----VTSNGVSVPDTKKVQITVNYP 210

  Fly   216 PIWSKTPFVSLKYAY--INGTATLMCEALAEPPANFTWYR-KHNKLHSNNRLYTIQSDSYWSSLT 277
            |.     ...:|.|.  :...|||.|:|:|.|||.|.||: :..:|.|.....:|:::|.||.:.
 Frog   211 PY-----ITDVKNAQSPVGRPATLRCKAMAVPPAEFEWYKDEKRRLISGTEGLSIKTESSWSVIV 270

  Fly   278 IHVLNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPAN 317
            ...:.:..:.||.|.|.|.||:...:.||   .||..|.|
 Frog   271 FSNVTSRHYGNYTCLASNKLGSFNSSLRL---LKPGDPLN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 16/88 (18%)
I-set 128..202 CDD:254352 20/73 (27%)
Ig 133..>193 CDD:299845 15/59 (25%)
IG_like 228..307 CDD:214653 27/81 (33%)
Ig 235..305 CDD:143165 25/70 (36%)
FN3 312..415 CDD:238020 2/5 (40%)
iglon5XP_002938252.1 Ig 31..123 CDD:299845 18/92 (20%)
IG_like 35..123 CDD:214653 16/89 (18%)
Ig 126..207 CDD:299845 21/94 (22%)
I-set 128..207 CDD:254352 21/92 (23%)
I-set 210..299 CDD:254352 28/93 (30%)
Ig 227..298 CDD:143165 25/70 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11647
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.