DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and chl1b

DIOPT Version :10

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_017212175.2 Gene:chl1b / 100318566 ZFINID:ZDB-GENE-091105-1 Length:1294 Species:Danio rerio


Alignment Length:374 Identity:86/374 - (22%)
Similarity:139/374 - (37%) Gaps:91/374 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ESLIVQCRS---PDPKVELHW------KSPKGEIIREHKGRIHIEQTSTEQLKIVFAHIALADKG 95
            |.|.::|.:   |.||||  |      |.|:..::..|...:.:|..:.|            |:|
Zfish   277 EDLQLECIAEGFPTPKVE--WVKIGFNKLPERVVVESHGKLLTVEMVNEE------------DEG 327

  Fly    96 NWSCEAADGSLHSK---SFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPNVTWHFNGQ 157
            .:.|.|.:.  |.:   .|.:.|.:...|........|..|....|.|.|||.|||.|.|..||:
Zfish   328 KYMCRAKNP--HGEVVHHFHVTV
EEPPEFEIEPQSQLVTIGADVLIKCVVKGNPQPTVGWRVNGR 390

  Fly   158 PISAGAADDSKFRILADGLL-INKVTQNDTGEYACRAYQVNSIASDMQERTV-LMKIEHKPIWSK 220
            |::  ....|..:||.||.: |:.....::..|.|.|  .|...:.:....: :|.|:       
Zfish   391 PLN--EVPTSNRKILKDGTISIHNANPENSAVYQCEA--TNKHGTILANANIMIMNIQ------- 444

  Fly   221 TPFV----SLKYAYINGTATLM-CEALAEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSLTIHV 280
             |.:    :|:|..:.|.:.:| |:..:.|.::.||.:..:........:|:..:   .||.||.
Zfish   445 -PLILTENNLQYMAVEGKSVVMHCKVFSSPASSITWSKADSANAVEGERFTVHQN---GSLEIHN 505

  Fly   281 LNTSAFDNYRCRARNDLGTIERTTRLEQGEKPPSPANFQLRGFNSNTFDVVLSAPRGPPDSPMGV 345
            :.......|.|.|:|..|.:.....||  .|.|:              .:|     .||.....:
Zfish   506 VMKEDMGEYSCFAQNTEGKVAIAATLE--VKDPT--------------RIV-----DPPRDLRVL 549

  Fly   346 NGFRIEYMTEMEFKTDAGK-----WTNARRKD-----------YAFEEG 378
            .|..|::..:.||....|.     |    .||           |..|:|
Zfish   550 AGTTIQFSCQPEFDPSFGDDFEVLW----EKDGIALNGSEDGRYILEDG 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 20/86 (23%)
IgI_Twitchin_like 120..208 CDD:409541 26/88 (30%)
Ig strand A 120..123 CDD:409541 1/2 (50%)
Ig strand A' 127..131 CDD:409541 0/3 (0%)
Ig strand B 134..141 CDD:409541 1/6 (17%)
Ig strand C 149..154 CDD:409541 2/4 (50%)
Ig strand C' 156..159 CDD:409541 1/2 (50%)
Ig strand D 165..170 CDD:409541 1/4 (25%)
Ig strand E 173..178 CDD:409541 2/5 (40%)
Ig strand F 187..195 CDD:409541 3/7 (43%)
Ig strand G 198..208 CDD:409541 0/9 (0%)
IG_like 228..307 CDD:214653 17/79 (22%)
Ig strand B 235..239 CDD:409353 1/4 (25%)
Ig strand C 248..252 CDD:409353 1/3 (33%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
FN3 312..415 CDD:238020 15/83 (18%)
chl1bXP_017212175.2 Ig 42..135 CDD:472250
Ig strand B 61..65 CDD:409396
Ig strand C 74..78 CDD:409396
Ig strand E 99..103 CDD:409396
Ig strand F 115..120 CDD:409396
Ig strand G 129..132 CDD:409396
Ig 144..234 CDD:472250
Ig strand B 158..162 CDD:409432
Ig strand C 172..176 CDD:409432
Ig strand E 195..199 CDD:409432
Ig strand F 210..215 CDD:409432
Ig strand G 226..229 CDD:409432
Ig 267..348 CDD:472250 20/86 (23%)
Ig strand B 279..283 CDD:409394 1/3 (33%)
Ig strand C 292..296 CDD:409394 3/5 (60%)
Ig strand E 314..318 CDD:409394 0/3 (0%)
Ig strand F 328..333 CDD:409394 1/4 (25%)
Ig strand G 341..344 CDD:409394 0/2 (0%)
Ig 359..438 CDD:472250 25/82 (30%)
Ig strand B 369..373 CDD:409367 1/3 (33%)
Ig strand C 382..386 CDD:409367 1/3 (33%)
Ig strand E 406..410 CDD:409367 1/3 (33%)
Ig strand F 420..425 CDD:409367 2/4 (50%)
Ig strand G 433..436 CDD:409367 0/2 (0%)
Ig 447..533 CDD:472250 20/90 (22%)
Ig strand B 463..467 CDD:409544 1/3 (33%)
Ig strand C 476..480 CDD:409544 1/3 (33%)
Ig strand E 499..503 CDD:409544 2/3 (67%)
Ig strand F 513..518 CDD:409544 2/4 (50%)
Ig strand G 526..529 CDD:409544 0/2 (0%)
Ig 535..635 CDD:472250 15/83 (18%)
Ig strand B 554..558 CDD:409359 1/3 (33%)
Ig strand C 571..575 CDD:409359 1/7 (14%)
Ig strand E 594..598 CDD:409359 1/1 (100%)
Ig strand F 608..613 CDD:409359
Ig strand G 621..624 CDD:409359
FN3 632..722 CDD:238020
FN3 <702..1101 CDD:442628
FN3 1070..1142 CDD:214495
Bravo_FIGEY 1196..1279 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.