DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and kirrel1b

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:337 Identity:75/337 - (22%)
Similarity:114/337 - (33%) Gaps:86/337 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NLAA-----LTAVAWANHHESLSLSPAEHSVVRYTNESLIVQCRSPDPKVELHWKSPKGEIIREH 68
            ||||     .|.....:|..::.||....||:.........|..:..|.:...|  .||.:|.:.
Zfish   208 NLAAPLGKRSTVTLNIHHPPTVILSIEPRSVLEGERVKFTCQATANPPIMGYRW--AKGGVILDG 270

  Fly    69 KGRIHIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLHSKSFDLIVYQKITFTENATVM----- 128
            ......|.|                        ||.|..::....:|:..:..| |.:::     
Zfish   271 ARESVFETT------------------------ADHSFFTEPVSCLVFNAVGST-NVSILVDVHF 310

  Fly   129 -----------TVKEGEKATILCEVKGEPQPNVTWHFNGQPISAGAADDSKFRILADG--LLINK 180
                       ||......|:.|:..|.|...:||...|..:           :|::.  |.:..
Zfish   311 GPILVVEPRPVTVDVDSDVTLNCKWSGNPPLTLTWTKKGSSM-----------VLSNSNQLFLKS 364

  Fly   181 VTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCE-ALAE 244
            |:|.|.|:|.|:|. |..|.  :.|..|.:.:...||.|..|   ::||.......:.|. |...
Zfish   365 VSQADAGQYVCKAI-VPRIG--VGETEVTLTVNGPPIISSEP---IQYAVRGEKGEIKCYIASTP 423

  Fly   245 PPANFTWYRKHNKLHSNN----RLYTI-------QSDSYWSSLTI-HVLNTSAFDNYRCRARNDL 297
            ||....|..|.|......    ..||:       |..:..|:||| :|:.......|.|.|.|..
Zfish   424 PPDKIVWAWKENVWEKERGTLLERYTVEQSRPATQGGAVLSTLTINNVMEADFQSTYNCTAWNAF 488

  Fly   298 G------TIERT 303
            |      |:|.|
Zfish   489 GPGTMIITLEET 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 13/81 (16%)
I-set 128..202 CDD:254352 20/91 (22%)
Ig 133..>193 CDD:299845 15/61 (25%)
IG_like 228..307 CDD:214653 25/95 (26%)
Ig 235..305 CDD:143165 23/88 (26%)
FN3 312..415 CDD:238020
kirrel1bXP_017212964.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.