DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and lrit3b

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b / 100144406 ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio


Alignment Length:221 Identity:43/221 - (19%)
Similarity:75/221 - (33%) Gaps:60/221 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SKSFDL--IVYQKITFTE--------NATVMTVKEGEKATILCEVKGEPQPNVTWHFNGQ----- 157
            |:..||  :.:|.:..:.        :||.:|...|....:.||..|.|.|.:.|..:.:     
Zfish   258 SEPLDLAGVPFQSVELSRCRRPYVVTSATKITALLGSTVLLRCEATGHPTPALMWIKSAKRNLYN 322

  Fly   158 ----PISAGAADDSKFRILADGLL--------------INKVTQNDTGEYACRAYQVNSIA---- 200
                ..:..:.|..:|.....|.:              :|.::.:|.|||.|||..:..|:    
Zfish   323 QGCCKQTQSSLDTERFPKKLFGYVQESPRVGVRWSVVSLNGISYSDAGEYRCRAQNMAGISEAVV 387

  Fly   201 ----------------SDMQERTVLMKIEHKPIWSKTPFVSLKYAYINGTATLMCEALAEPPANF 249
                            ||.|:.|.  |.:.|....|....::....:.|:.:.:...|..|.|..
Zfish   388 SLNVVGVMAEYTDFKNSDQQQTTT--KSDSKRTKPKQKSKAMMPRNMTGSLSPLKRVLKTPKAGR 450

  Fly   250 TWYRKH----NKLHSNNRLYTIQSDS 271
            ...::.    .|| |:....|...||
Zfish   451 DKMKRDRTAVQKL-SHRHFLTASDDS 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 3/8 (38%)
I-set 128..202 CDD:254352 20/116 (17%)
Ig 133..>193 CDD:299845 16/82 (20%)
IG_like 228..307 CDD:214653 10/48 (21%)
Ig 235..305 CDD:143165 9/41 (22%)
FN3 312..415 CDD:238020
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470
leucine-rich repeat 69..89 CDD:275380
LRR_8 112..172 CDD:290566
leucine-rich repeat 114..137 CDD:275378
leucine-rich repeat 138..161 CDD:275378
LRR_8 160..214 CDD:290566
LRR_4 160..201 CDD:289563
leucine-rich repeat 162..185 CDD:275378
leucine-rich repeat 186..199 CDD:275378
leucine-rich repeat 215..230 CDD:275378
Ig 278..391 CDD:299845 22/112 (20%)
I-set 279..391 CDD:254352 22/111 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.