DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fipi and vsig10

DIOPT Version :9

Sequence 1:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001093564.2 Gene:vsig10 / 100005564 ZFINID:ZDB-GENE-030131-7476 Length:529 Species:Danio rerio


Alignment Length:321 Identity:71/321 - (22%)
Similarity:118/321 - (36%) Gaps:90/321 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLSLSPAEHSVVRYTNESLIV--------QCRS-PDPKVELHW-------KSPKGEIIREHKGRI 72
            ||.:|||..    ..|.:|.|        .|.| .:|...|.|       .:|:.|.        
Zfish   124 SLDISPATF----LNNGTLFVHKGSNVNFSCSSESNPSQNLTWTVDNLASDNPEREF-------- 176

  Fly    73 HIEQTSTEQLKIVFAHIALADKGNWSCEAADGSLH----SKSFDLIVYQKITFTENATVMTVKEG 133
                .|...|.....:|...|:|.::| .:..:|.    :|:.:|:||..   .|.....:.:.|
Zfish   177 ----GSKSPLAFSITNIQPLDQGTYTC-TSQNTLSRRTANKTQELLVYYA---PERHPECSWELG 233

  Fly   134 EKAT---ILCE-VKGEPQPNVTWHFNGQPISAGAADDSKFRILAD------GLLINKVTQNDTGE 188
            :|.:   .:|. ..|.|.|.:||    |.:. |||:.....:...      .:.:|:...:|..:
Zfish   234 DKPSDVLFICSWFGGYPVPTLTW----QEVE-GAAEGPTINLTTSQQTEELNVSVNRSILHDGDK 293

  Fly   189 YACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYAY---------INGT-ATLMC-EAL 242
            ..|..:.|..:                   .|:...:||..|         :.|| .|:.| |..
Zfish   294 VKCTGHHVTGV-------------------EKSCSFTLKIPYPTGQPLATALEGTNITISCTETS 339

  Fly   243 AEPPANFTWYRKHNKLHSNNRLYTIQSDSYWSSLTIHVLNTSAFDN--YRCRARNDLGTIE 301
            :.|||...| :|::.|..|...|.:|.:.  .:||:.::|.:..|.  |.|.:.|.||..|
Zfish   340 SLPPAKTVW-KKNDDLIENTSKYIVQENR--PALTLTIVNVTKADEGVYYCYSENPLGARE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fipiNP_787975.1 IG_like 33..115 CDD:214653 19/101 (19%)
I-set 128..202 CDD:254352 16/83 (19%)
Ig 133..>193 CDD:299845 15/69 (22%)
IG_like 228..307 CDD:214653 25/87 (29%)
Ig 235..305 CDD:143165 22/70 (31%)
FN3 312..415 CDD:238020
vsig10NP_001093564.2 IG_like 28..116 CDD:214653
Ig 32..104 CDD:299845
IG_like 140..204 CDD:214653 14/76 (18%)
IGc2 143..203 CDD:197706 13/72 (18%)
IG_like 324..404 CDD:214653 24/77 (31%)
Ig 328..404 CDD:299845 24/73 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.