DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and AT5G67170

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001318894.1 Gene:AT5G67170 / 836852 AraportID:AT5G67170 Length:375 Species:Arabidopsis thaliana


Alignment Length:327 Identity:64/327 - (19%)
Similarity:114/327 - (34%) Gaps:69/327 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKWKTFRRFVSGD--FDEYLWHLGKTKTAGTIL 99
            |.:..||.:|:|:...:..|.:.|...|.|:....:.|..|:..|  |::|...:....|....:
plant    45 DGNCFFRAIADQLEGNEDEHNKYRNMIVLYIVKNREMFEPFIEDDVPFEDYCKTMDDDGTWAGNM 109

  Fly   100 ELGAMCHLYRRNVIIYEPFDMGRMVTYNKDYK-EILRIFMNSMGHFETVLTMQDVDMAAVCQSVS 163
            ||.|...:.|.|:.|:........:...:|.: .::.:..:...|:.:|.:.:|     .|...:
plant   110 ELQAASLVTRSNICIHRNMSPRWYIRNFEDTRTRMIHLSYHDGEHYNSVRSKED-----ACGGPA 169

  Fly   164 FKMLYKHLFRLPDVDLAVEWMLYPDTFKMGTEYEFDSRGRAIRLLCR-NGRSFKLDRPESTICLL 227
            ..::.       :.|..|.     ...|.....|..|:.:|.:  |. |..:.|           
plant   170 RPVVI-------EADAKVS-----AASKQAKATESKSKNKADK--CHVNAGAIK----------- 209

  Fly   228 ENSQMCPFHNRRLAMGGQFADFS--CMRILLEEN---NIPFSYLVA-KSMDPCRYRNVELTSAI- 285
                        :.|.|...|.:  ..::||:.|   :....:|:| :.|:.....:.|..||. 
plant   210 ------------VVMSGSCCDNTEKAEQVLLQVNGDVDAAIEFLIADQGMESLTENDTETASASD 262

  Fly   286 ----------------EARREAYEFGIYIGDYNFKVGAKCQVQLDTNRRDLLSACYIQSIDKKKS 334
                            :||.|..|.....|:.:..|.|||..|.|..:......|...|..|.||
plant   263 TINPKHASDSPMENTEQAREELIEEESASGNNSETVQAKCTTQTDDKKIPRNKTCPCGSKKKYKS 327

  Fly   335 VC 336
            .|
plant   328 CC 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 20/79 (25%)
AT5G67170NP_001318894.1 OTU 43..155 CDD:418725 22/109 (20%)
secA <247..331 CDD:237255 21/83 (25%)
SWIM_PBPRA1643 <296..330 CDD:200353 12/34 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.