DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and AT3G22260

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001189948.1 Gene:AT3G22260 / 821796 AraportID:AT3G22260 Length:245 Species:Arabidopsis thaliana


Alignment Length:145 Identity:33/145 - (22%)
Similarity:56/145 - (38%) Gaps:18/145 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 MLGDASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKWKTFRRFVSGDFDEYLWHLGKTKTAGTI 98
            |.||.:..||.:|:|::.....|..||...|:.:..:.|.:..:|...:..|...:.|....|..
plant   106 MEGDGNCQFRALADQLFRNADYHKHVRKHVVKQLKQQRKLYEEYVPMKYRHYTRKMKKHGEWGDH 170

  Fly    99 LELGAMCHLYRRNVIIYEPFDMGRMVTYNKDYKEILRIFMNSMGHFETVLTMQDVDMAAVCQSVS 163
            :.|.|....:...:.:...|       .::.|.|||....|.:.  |..|:.        ...|.
plant   171 VTLQAAADRFEAKICLVTSF-------RDQSYIEILPHNKNPLR--EAWLSF--------WSEVH 218

  Fly   164 FKMLYKH-LFRLPDV 177
            :..||.: :..||||
plant   219 YNSLYANGVLALPDV 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 17/78 (22%)
AT3G22260NP_001189948.1 OTU 108..>192 CDD:418725 18/90 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.