DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and AT3G02070

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001319447.1 Gene:AT3G02070 / 821202 AraportID:AT3G02070 Length:219 Species:Arabidopsis thaliana


Alignment Length:136 Identity:28/136 - (20%)
Similarity:56/136 - (41%) Gaps:6/136 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RFLERRQLF---RKHMLGDASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKWKTFRRFVSGDFD 83
            |.|:|..::   ...:.||.:..||.:::|:|.:...|.:||.|.|:.:......:..:|...:.
plant    69 RLLQRLNVYGLCELKVSGDGNCQFRALSDQLYRSPEYHKQVRREVVKQLKECRSMYESYVPMKYK 133

  Fly    84 EYLWHLGKTKTAGTILELGAMCHLYRRNVIIYEPFDMGRMVTYNKDY---KEILRIFMNSMGHFE 145
            .|...:||....|..:.|.|....:...:.:...|.....:.....|   |.:|.:...|..|:.
plant   134 RYYKKMGKFGEWGDHITLQAAADRFAAKICLLTSFRDTCFIEIIPQYQAPKGVLWLSFWSEVHYN 198

  Fly   146 TVLTMQ 151
            ::..:|
plant   199 SLYDIQ 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 18/78 (23%)
AT3G02070NP_001319447.1 OTU 86..>170 CDD:418725 19/83 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.