DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and AT2G39320

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_181464.1 Gene:AT2G39320 / 818517 AraportID:AT2G39320 Length:189 Species:Arabidopsis thaliana


Alignment Length:32 Identity:12/32 - (37%)
Similarity:17/32 - (53%) Gaps:0/32 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 MLGDASSLFRVVAEQVYDTQMLHYEVRMECVR 65
            |..|.:..||.:|:|:|.....|..||.|.|:
plant     2 MKSDGNCQFRALADQLYQNSDCHELVRQEIVK 33

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 11/30 (37%)
AT2G39320NP_181464.1 OTU 3..>66 CDD:388712 11/31 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.