powered by:
Protein Alignment CG3251 and AT2G39320
DIOPT Version :9
Sequence 1: | NP_608851.1 |
Gene: | CG3251 / 33671 |
FlyBaseID: | FBgn0031622 |
Length: | 495 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_181464.1 |
Gene: | AT2G39320 / 818517 |
AraportID: | AT2G39320 |
Length: | 189 |
Species: | Arabidopsis thaliana |
Alignment Length: | 32 |
Identity: | 12/32 - (37%) |
Similarity: | 17/32 - (53%) |
Gaps: | 0/32 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 MLGDASSLFRVVAEQVYDTQMLHYEVRMECVR 65
|..|.:..||.:|:|:|.....|..||.|.|:
plant 2 MKSDGNCQFRALADQLYQNSDCHELVRQEIVK 33
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG3251 | NP_608851.1 |
OTU |
36..>115 |
CDD:303090 |
11/30 (37%) |
AT2G39320 | NP_181464.1 |
OTU |
3..>66 |
CDD:388712 |
11/31 (35%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2605 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.