DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and ALG13

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_011529330.1 Gene:ALG13 / 79868 HGNCID:30881 Length:1161 Species:Homo sapiens


Alignment Length:406 Identity:118/406 - (29%)
Similarity:186/406 - (45%) Gaps:82/406 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IDRFLERRQLFRKHMLGDASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKWKTFRRFVSGDFDE 84
            :|.:|....||||....|||.|||.::||::.:|:.|.|:|..||.||....:||..:|.|.|::
Human   222 MDEYLGSLGLFRKLTAKDASCLFRAISEQLFCSQVHHLEIRKACVSYMRENQQTFESYVEGSFEK 286

  Fly    85 YLWHLGKTKTAGTILELGAMCHLYRRNVIIYE-PFDMGRMVTYNKD--YKEILRIFMNSMGHFET 146
            ||..||..|.:...||:.|:..:|.|:.|:|. |   |:..||..|  |::.:.:..:|.||:::
Human   287 YLERLGDPKESAGQLEIRALSLIYNRDFILYRFP---GKPPTYVTDNGYEDKILLCYSSSGHYDS 348

  Fly   147 VLTMQDVDMAAVCQSVSFKMLYKHLFRLPDVDLAVEWMLYPDTFKMG------------TEYEFD 199
            |.:.|....|||||:|.:::|||.:|.:.:.:|.....|:....|..            |:|:..
Human   349 VYSKQFQSSAAVCQAVLYEILYKDVFVVDEEELKTAIKLFRSGSKKNRNNAVTGSEDAHTDYKSS 413

  Fly   200 SRGRAIRL-LCRNGRSFKLDRPESTICLLENSQMCPFHNRRLAMGGQFADFSCMRILLEE----- 258
            ::.|.... .|.|..:.    ||.             :|:.                .||     
Human   414 NQNRMEEWGACYNAENI----PEG-------------YNKG----------------TEETKSPE 445

  Fly   259 --NNIPFSYLVAKSMDPCRYRNVELTSAIEARREAYEFGIYIGDY------NFKVGAKCQVQLDT 315
              :.:||.|.|.|::||..|||||....:::|:|..:     .||      .:.:|.||||.|::
Human   446 NPSKMPFPYKVLKALDPEIYRNVEFDVWLDSRKELQK-----SDYMEYAGRQYYLGDKCQVCLES 505

  Fly   316 NRRDLLSACYIQSIDKKKSVCKVFIEEQGKLVDVPSDNLHPLPP-DEFKAWDFARKRPQRLHNSQ 379
            ..|  ....:||.:..:.:...|||||..:...||..||.|:.. ....||:....|..|     
Human   506 EGR--YYNAHIQEVGNENNSVTVFIEELAEKHVVPLANLKPVTQVMSVPAWNAMPSRKGR----- 563

  Fly   380 MGRQSVQGDQQGFVPD 395
             |.|.:.|   |:||:
Human   564 -GYQKMPG---GYVPE 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 32/78 (41%)
ALG13XP_011529330.1 Glycosyltransferase_GTB_type 4..>120 CDD:299143
OTU 239..345 CDD:303090 40/108 (37%)
TUDOR 496..544 CDD:119391 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9797
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8659
orthoMCL 1 0.900 - - OOG6_114775
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2026
SonicParanoid 1 1.000 - - X1801
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.740

Return to query results.
Submit another query.