DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and Otud6b

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_036020347.1 Gene:Otud6b / 72201 MGIID:1919451 Length:298 Species:Mus musculus


Alignment Length:176 Identity:39/176 - (22%)
Similarity:67/176 - (38%) Gaps:46/176 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QRLASTEVRK---AR----DPIDRFLERRQLFRKHMLGDASSLFRVVAEQV--YDTQMLHYEVRM 61
            :|:|..|:..   ||    :.:.:.|..|:|..|.:..|...::..:.:|:  .|..:....:|.
Mouse   122 ERIAEAEIENLSGARHLESEKLAQILAARELEIKQIPSDGHCMYGALEDQLREQDCALTVASLRR 186

  Fly    62 ECVRYMFTKWKTFRRFV----SGD------FDEYLWHLGKTKTAGTILELGAMCHL--------- 107
            :...||.|....|..|:    :||      |.:|...:..|...|..|||.|:.|:         
Mouse   187 QTAEYMQTHSDDFLPFLTNPSTGDMYTPEEFGKYCDDIVNTAAWGGQLELRALSHILQTPIEILQ 251

  Fly   108 -----------YRRN--VIIYEPFDMGRMVTYNKDYKEILRIFMNS 140
                       |.||  |::|    |.......:.|..:.|: :||
Mouse   252 ADAPPIIVGEEYPRNPLVLVY----MRHAYGLGEHYNSVTRL-VNS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 24/112 (21%)
Otud6bXP_036020347.1 OTU 158..283 CDD:396767 26/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.