DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and Alg13

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_080523.2 Gene:Alg13 / 67574 MGIID:1914824 Length:165 Species:Mus musculus


Alignment Length:119 Identity:25/119 - (21%)
Similarity:42/119 - (35%) Gaps:45/119 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RFVSGDFDEYLWHLGKTKTAGTILELGAMCHLYRRNVIIYEPFDMGRMVTYNKD---YKEILRIF 137
            |.|:.|..:.|..||...   .:|::|       |..::.:||   |..::..|   ||:.|:  
Mouse    19 RVVANDCVQILESLGYNH---LVLQVG-------RGTVVPKPF---RTESFTLDVYRYKDSLK-- 68

  Fly   138 MNSMGHFETVLTMQDVDM------AAVCQS-----------VSFKMLYKHLFRL 174
                      ..:|..|:      |..|..           |:.|::..|.|.|
Mouse    69 ----------EDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKLMNNHQFEL 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 9/38 (24%)
Alg13NP_080523.2 Glycosyltransferase_GTB_type 5..>120 CDD:299143 25/119 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9886
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44368
orthoMCL 1 0.900 - - OOG6_114775
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2026
SonicParanoid 1 1.000 - - X1801
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.