DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and OTUD5

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_005278096.1 Gene:OTUD5 / 55593 HGNCID:25402 Length:572 Species:Homo sapiens


Alignment Length:188 Identity:49/188 - (26%)
Similarity:81/188 - (43%) Gaps:19/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ERRQLFRKHMLGDASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKWKTFRRFVSGDFDEYLWHL 89
            :::....|.|..|.:.|||.||:|||..|.:|..||..|:.|:......|..:|:.||..|:...
Human   209 DKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRK 273

  Fly    90 GKTKTAGTILELGAMCHLYRRNVIIY---------EPFDMGRMVTYNKDYKEILRIFMNSMGHFE 145
            .|....|..:|:.||..:|.|.|.:|         ||.:....:..|:|  |.:|:..:...|:.
Human   274 RKNNCHGNHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNED--EPIRVSYHRNIHYN 336

  Fly   146 TVLTMQDVDMAAVCQSVSFK------MLYKHLFRLPDVDLAVEWMLYPDTFKMGTEYE 197
            :|:......:.......|||      .|.|:..:..:.....:.||  :..|..|::|
Human   337 SVVNPNKATIGVGLGLPSFKPGFAEQSLMKNAIKTSEESWIEQQML--EDKKRATDWE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 28/78 (36%)
OTUD5XP_005278096.1 OTU 221..335 CDD:303090 35/115 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4984
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12419
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.