DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and otud5a

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001068578.1 Gene:otud5a / 555459 ZFINID:ZDB-GENE-030616-61 Length:560 Species:Danio rerio


Alignment Length:183 Identity:49/183 - (26%)
Similarity:80/183 - (43%) Gaps:14/183 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ERRQLFRKHMLGDASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKWKTFRRFVSGDFDEYLWHL 89
            |::....|.|..|.:.|||.||:|||..|.:|..||..|:.|:......|..:|:.||..|:...
Zfish   207 EKKGFVIKKMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRK 271

  Fly    90 GKTKTAGTILELGAMCHLYRRNVIIY----EPFDMGRMVTYNKDYKEILRIFMNSMGHFETVLTM 150
            .|....|..:|:.||..:|.|.|.:|    ||.:....:..|.|  |.:|:..:...|:.:|:..
Zfish   272 RKNNCHGNHIEMQAMAEMYNRPVEVYQSGTEPINTFHGIHQNND--EPIRVSYHRNIHYNSVVNP 334

  Fly   151 QDVDMAAVCQSVSFK------MLYKHLFRLPDVDLAVEWMLYPDTFKMGTEYE 197
            ....:.......:||      .|.|:..:..:.....:.||  :..|..|::|
Zfish   335 NKATIGVGLGLPAFKPGFADQSLMKNAIKTSEESWIEQQML--EDKKRATDWE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 28/78 (36%)
otud5aNP_001068578.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..105
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..190
Cys-loop. /evidence=ECO:0000250 216..222 2/5 (40%)
OTU 219..328 CDD:303090 35/110 (32%)
Variable-loop. /evidence=ECO:0000250 271..281 2/9 (22%)
His-loop. /evidence=ECO:0000250 322..327 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..496
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12419
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.