DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and OTUD4

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_011530342.2 Gene:OTUD4 / 54726 HGNCID:24949 Length:1121 Species:Homo sapiens


Alignment Length:426 Identity:120/426 - (28%)
Similarity:191/426 - (44%) Gaps:74/426 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RKARDPIDRFLERRQLFRKHMLGDASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKWK------ 72
            |:...|:|.:|.:..|:||.:..|.|.|||.|||||..:|..|.||||.|:.|:....:      
Human    19 REDATPMDAYLRKLGLYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIHYLRENREKFEAVT 83

  Fly    73 -TFRRFVSGDFDEYLWHLGKTKTAGTILELGAMCHLYRRNVIIY-EPFDMGRMVTYNKDYKEILR 135
             .|:.|:.|.|:|||..|...:.....:|:.|:..:||::.||| ||......||.|...:::|.
Human    84 CNFKHFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLL 148

  Fly   136 IFMNSMGHFETVLTMQDVDMAAVCQSVSFKMLYKHLFRLPDVDLAVEWMLYPDTFKMGTE----- 195
            .|.|. .|::.|..::..:.:|:|||:.:::||:.:|:.....:.:|.    ||.::..|     
Human   149 CFSNG-NHYDIVYPIKYKESSAMCQSLLYELLYEKVFKTDVSKIVMEL----DTLEVADEDNSEI 208

  Fly   196 --YEFDSRGRAIRLLCRNGRSFKLDRPESTICLLENSQMCPFHNRRLAMGGQFADFSCMRILLEE 258
              .|.||..........:...||   |.|             .|.:|...|            ..
Human   209 SDSEDDSCKSKTAAAAADVNGFK---PLS-------------GNEQLKNNG------------NS 245

  Fly   259 NNIPFSYLVAKSMDPCRYRNVELTSAIEAR--REAYEFGIYIGDYNFKVGAKCQVQLDTNRRDLL 321
            .::|.|..|.||::|..|||||....::::  ::..::.|..| ..::||.||||:||.|.:.|.
Human   246 TSLPLSRKVLKSLNPAVYRNVEYEIWLKSKQAQQKRDYSIAAG-LQYEVGDKCQVRLDHNGKFLN 309

  Fly   322 SACYIQSIDKKKSVCKVFIEEQGKLVDVPSDNLHPLPPDEFKAWDFARKRPQRLHNSQMGRQSVQ 386
            :.  :|.|..:..  .|.:||.||  ...|.||...||:   :|:       .:...:|.:.|..
Human   310 AD--VQGIHSENG--PVLVEELGK--KHTSKNLKAPPPE---SWN-------TVSGKKMKKPSTS 358

  Fly   387 G-------DQQGFVPDPMPGTAPSMPPPPVADPRPV 415
            |       |.:|......|..|||..||.:..|..|
Human   359 GQNFHSDVDYRGPKNPSKPIKAPSALPPRLQHPSGV 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 31/85 (36%)
OTUD4XP_011530342.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145152
Domainoid 1 1.000 67 1.000 Domainoid score I9797
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8659
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12419
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2026
SonicParanoid 1 1.000 - - X1801
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.