DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and OTUD6B

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_057107.4 Gene:OTUD6B / 51633 HGNCID:24281 Length:293 Species:Homo sapiens


Alignment Length:175 Identity:39/175 - (22%)
Similarity:78/175 - (44%) Gaps:31/175 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QRLASTEVRK---AR----DPIDRFLERRQLFRKHMLGDASSLFRVVAEQV--YDTQMLHYEVRM 61
            :|:|..|:..   ||    :.:.:.|..|||..|.:..|...:::.:.:|:  .|..:....:|.
Human   117 ERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGHCMYKAIEDQLKEKDCALTVVALRS 181

  Fly    62 ECVRYMFTKWKTFRRFV----SGD------FDEYLWHLGKTKTAGTILELGAMCHLYRRNVIIYE 116
            :...||.:..:.|..|:    :||      |.:|...:..|...|..|||.|:.|:.:..:.|.:
Human   182 QTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVNTAAWGGQLELRALSHILQTPIEIIQ 246

  Fly   117 ----PFDMGRMVTYNKDYKEILRIFMN---SMG-HFETVLTMQDV 153
                |..:|.  .|:|  |.::.::|.   .:| |:.:|..:.::
Human   247 ADSPPIIVGE--EYSK--KPLILVYMRHAYGLGEHYNSVTRLVNI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 19/90 (21%)
OTUD6BNP_057107.4 COG5539 18..280 CDD:227826 38/166 (23%)
Cys-loop. /evidence=ECO:0000250 152..158 1/5 (20%)
OTU 153..278 CDD:280496 27/128 (21%)
Variable-loop. /evidence=ECO:0000250 219..229 2/9 (22%)
His-loop. /evidence=ECO:0000250 267..277 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.