DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and Otud3

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_038966554.1 Gene:Otud3 / 500572 RGDID:1560468 Length:423 Species:Rattus norvegicus


Alignment Length:168 Identity:37/168 - (22%)
Similarity:63/168 - (37%) Gaps:34/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GDASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKWKTFRRFVSGD--FDEYLWHLGKTKTAGTI 98
            ||.:.|||.:.:|:......|.:.|.|.|.||..:.:.|..||..|  |::::..|.|..|....
  Rat    71 GDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIRQREDFEPFVEDDIPFEKHVASLAKPGTFAGN 135

  Fly    99 LELGAMCHLYRRNVIIY-------------------------------EPF-DMGRMVTYNKDYK 131
            ..:.|....::.||:|:                               ||. ..|::...:|...
  Rat   136 DAIVAFARNHQLNVVIHQLNAPLWQIISKCLSFRLQQTWVCFWVSHQKEPVQSRGQIRGTDKSSA 200

  Fly   132 EILRIFMNSMGHFETVLTMQDVDMAAVCQSVSFKMLYK 169
            ..|.|......|:::|..:.|...|.......|:||::
  Rat   201 RELHIAYRYGEHYDSVRRINDNSEAPAHLLTDFQMLHQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 23/80 (29%)
Otud3XP_038966554.1 OTU 70..>156 CDD:418725 24/84 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.