DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and otud3

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001005056.1 Gene:otud3 / 448607 XenbaseID:XB-GENE-5795843 Length:407 Species:Xenopus tropicalis


Alignment Length:352 Identity:63/352 - (17%)
Similarity:115/352 - (32%) Gaps:107/352 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GDASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKWKTFRRFVSGD--FDEYLWHLGKTKTAGTI 98
            ||.:.|||.:.:|:......|...|.|.|.||......|..||..|  ||.::.:|.|:.|....
 Frog    66 GDGNCLFRALGDQIEGHSRNHLRHRHETVEYMIKHRDDFEPFVEDDVPFDRHVANLAKSGTFAGN 130

  Fly    99 LELGAMCHLYRRNVIIYE---PF------------DMGRMVTYNKDYKEILRIFMNS--MGHFET 146
            ..:.|.....:.||:|::   |.            ::.....|.:.|..:.||..|:  ..:.:|
 Frog   131 DAIVAFARNNQVNVVIHQLNNPLWHIRGSDKADSRELHIAYRYGEHYDSVRRINDNAEMPANLQT 195

  Fly   147 VLTMQD----------------------------------VDMAAVCQSVSFKMLYKHLFRLPDV 177
            .:..:|                                  .|:..:.||:..:..        |:
 Frog   196 EMLSKDKANQRSRQKKPSVSDDRSELHDDAVQKVRNATGCADIPLILQSLEAESY--------DI 252

  Fly   178 DLAVEWMLYPDTFKMGTEYEFDSRGRAIRLLCRNGRSFKLDRPESTICLLENSQMCPFHNRRLAM 242
            |.|:..:|..:..::                        :|......|..:.|. ||:.:..| .
 Frog   253 DSAIHSILQIEELRL------------------------IDNDNYQDCAADASN-CPYSSGSL-H 291

  Fly   243 GGQFADFSCMRILLEEN-NIPFSYLVAKSMDPCRYRNVELTSAIEARREAYEFGIYIGDYNFKVG 306
            ..::.:..|:....:|| |:..:.....:.||    .:...::::||....|         .|..
 Frog   292 SNEYGESDCLGQEQKENSNLDVTERWTGNADP----GLAEGASVDARSTTQE---------HKAS 343

  Fly   307 AKCQVQLDTNRRDLLSACYIQSIDKKK 333
            .:.|...:..|:|.      |...|||
 Frog   344 KEQQKLSNKQRKDQ------QRQQKKK 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 24/80 (30%)
otud3NP_001005056.1 OTU 65..177 CDD:388712 27/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.