DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and tango2

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001004885.1 Gene:tango2 / 448223 XenbaseID:XB-GENE-948934 Length:276 Species:Xenopus tropicalis


Alignment Length:120 Identity:29/120 - (24%)
Similarity:46/120 - (38%) Gaps:17/120 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 FSYLVAKSMDPCRYRNVELTSA-IEARREAYEFGIYIGDYNFK---------VGAKCQVQLDTNR 317
            ||||...|.:...|....|.:| ..:.:|  :...|.|....:         .|..|.: |||..
 Frog   103 FSYLKKISAEGHLYNGFNLLAADFNSTKE--DVMCYYGSKGEQEPLILNPGVYGLSCSL-LDTPW 164

  Fly   318 RDLL--SACYIQSIDKKKSVCKV-FIEEQGKLVDVPSDNLHPLPPDEFKAWDFAR 369
            |.|.  ...:...|.|.:.:.:. .::|..|:::.....| |.|..|.:..||.|
 Frog   165 RKLQHGKKLFADIIRKSQDIAREDLVQELIKVMNNEEQQL-PDPAIEEQGKDFVR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090
tango2NP_001004885.1 TANGO2 1..259 CDD:377554 29/120 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.