DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and otud5

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001004849.1 Gene:otud5 / 448134 XenbaseID:XB-GENE-6455884 Length:518 Species:Xenopus tropicalis


Alignment Length:183 Identity:51/183 - (27%)
Similarity:80/183 - (43%) Gaps:14/183 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ERRQLFRKHMLGDASSLFRVVAEQVYDTQMLHYEVRMECVRYMFTKWKTFRRFVSGDFDEYLWHL 89
            |::....|.|..|.:.|||.||:|||..|.:|..||..|:.|:......|..:|:.||..|:...
 Frog   167 EKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRK 231

  Fly    90 GKTKTAGTILELGAMCHLYRRNVIIY----EPFDMGRMVTYNKDYKEILRIFMNSMGHFETVLTM 150
            .|....|..:|:.||..:|.|.|.:|    ||.:....:..|:|  |.:|:..:...|:.:|:..
 Frog   232 RKNNCHGNHIEMQAMAEMYNRPVEVYQYGTEPINTFHGIQQNED--EPIRVSYHRNIHYNSVVNP 294

  Fly   151 QDVDMAAVCQSVSFK------MLYKHLFRLPDVDLAVEWMLYPDTFKMGTEYE 197
            ....:.......|||      .|.|...|..:.....:.||  :..|..|::|
 Frog   295 NKATIGVGLGLPSFKPGFAEQSLMKSAIRTSEESWIEQQML--EDKKRATDWE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 28/78 (36%)
otud5NP_001004849.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..79
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 105..144
Cys-loop. /evidence=ECO:0000250 176..182 2/5 (40%)
OTU 179..288 CDD:303090 35/110 (32%)
Variable-loop. /evidence=ECO:0000250 231..241 2/9 (22%)
His-loop. /evidence=ECO:0000250 282..287 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12419
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.