DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and otud5b

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001314694.1 Gene:otud5b / 445146 ZFINID:ZDB-GENE-040801-50 Length:537 Species:Danio rerio


Alignment Length:204 Identity:49/204 - (24%)
Similarity:90/204 - (44%) Gaps:15/204 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LQRLASTEVRKARDPIDRFLERRQLFR-KHMLGDASSLFRVVAEQVYDTQMLHYEVRMECVRYMF 68
            ||.:......:..:..::.|..::.|. |.|..|.:.|||.||:|:|..|.:|..:|.:|:.|:.
Zfish   169 LQLVDPATAEQQEEWFEKALREKKGFEIKKMKEDGACLFRAVADQIYGDQDMHDVIRKQCMDYLT 233

  Fly    69 TKWKTFRRFVSGDFDEYLWHLGKTKTAGTILELGAMCHLYRRNVIIY----EPFDMGRMVTYNKD 129
            .....|..:|:.||..|:....|....|..:|:.||..::.|.|.:|    ||.::...:..|.|
Zfish   234 KNADYFSSYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMFNRPVEVYQYGIEPINIFHGIQENND 298

  Fly   130 YKEILRIFMNSMGHFETVLTMQDVDMAAVCQSVSFK------MLYKHLFRLPDVDLAVEWMLYPD 188
              :.:|:..:...|:.:|:......:.......|||      .|.|:..:..:.....:.||  :
Zfish   299 --DPIRVSYHKNIHYNSVVNPYKASVGVGLGLPSFKPGFADQCLMKNAIKTSEESWIEQQML--E 359

  Fly   189 TFKMGTEYE 197
            ..|..|::|
Zfish   360 DKKRATDWE 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 25/78 (32%)
otud5bNP_001314694.1 OTU 202..311 CDD:303090 31/110 (28%)
MSA-2c <349..474 CDD:289042 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2605
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12419
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.