DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3251 and Otud6a

DIOPT Version :9

Sequence 1:NP_608851.1 Gene:CG3251 / 33671 FlyBaseID:FBgn0031622 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001156663.1 Gene:Otud6a / 408193 MGIID:3644685 Length:290 Species:Mus musculus


Alignment Length:126 Identity:25/126 - (19%)
Similarity:51/126 - (40%) Gaps:22/126 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QRLASTEVRKARDPIDRFLERRQLFRKHMLGDASSLFRVVAEQVYDTQMLHYEVRMECVRY---- 66
            ::||:.. |:..:.:...|..:.|..|.:..|...::|.:.:|      |.:.|.:|.:||    
Mouse   120 EQLAANR-REEEEKVAAILGAKNLEMKTIPADGHCMYRAIQDQ------LVFSVTIESLRYRTAY 177

  Fly    67 -----------MFTKWKTFRRFVSGDFDEYLWHLGKTKTAGTILELGAMCHLYRRNVIIYE 116
                       .||:.:....:...||..|...:....:.|..|||.|:.|:.:..:.:.:
Mouse   178 YMRKHIDDFLPFFTEPEAGNFYTREDFLRYCDDIVHNASWGGQLELRALSHVLQTPIEVVQ 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3251NP_608851.1 OTU 36..>115 CDD:303090 19/93 (20%)
Otud6aNP_001156663.1 COG5539 5..272 CDD:227826 25/126 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..117
Cys-loop. /evidence=ECO:0000250 147..153 1/5 (20%)
OTU 148..270 CDD:280496 19/97 (20%)
Variable-loop. /evidence=ECO:0000250 211..221 1/9 (11%)
His-loop. /evidence=ECO:0000250 259..269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835260
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.